Patenty so značkou «viažúce»

Látky viažuce amyloid

Načítavanie...

Číslo patentu: E 19218

Dátum: 10.12.2010

Autori: Yang Jerry, Theodorakis Emmanuel

MPK: A61K 31/5377, A61K 31/277, A61P 25/28...

Značky: viažúce, amyloid, látky

Text:

...prvom aspekte sú poskytnuté zlúčeniny, ktoré viažu amyloidné peptidy a/alebo amyloidy0004 V ďalšom aspekte je poskytnutá farrnaceutická kompozícia. Fannaceutickákompozícia zahrnuje tu nárokovanú zlúčeninu a farmaceutický prijateľnú pomocnú látku.0005 V ďalšom aspekte je poskytnuté použitie vspôsobe liečby ochorenia charakterizovaného akumuláciou amyloidov (napr. amyloidných usadenín) u subjektu. Použitie V týchto spôsoboch zahmuje...

Protilátky, viažuce sa na ľudskú CSF1R extracelulárnu doménu 4 a ich použitie

Načítavanie...

Číslo patentu: E 20502

Dátum: 07.12.2010

Autori: Seeber Stefan, Kaluza Klaus, Dimoudis Nikolaos, Fertig Georg, Lanzendoerfer Martin, Thomas Marlene, Ries Carola, Fidler Alexander

MPK: C07K 16/28, A61P 35/00, A61P 37/00...

Značky: extracelulárnu, viažúce, csf1r, použitie, protilátky, doménu, ľudskú

Text:

...(2003) 1143-ll 55, Pixley, F. J., a kol., Trends Cell Biol 14 (2004) 628-638).0007 Ďalšia signalizácia je sprostredkovaná pomocou p 85 podjednotky PI 3 K a Grb 2 m spojujúcej sa s PI 3 K/AKT a Ras/MAPK cestami, resp. Tieto dve dôležité signalizačné dráhy môžu regulovať proliferáciu, prežitie a apoptózu. Ďalšie signalizačné molekuly, ktoré sa viažu na fosforylovanú intracelulárnu doménu CSF-1 R zahrnujú STAT 1, STAT 3, PLCy a Cbl0008 CSF-1 R...

Nové zlúčeniny viažuce a modulujúce aktivitu FXR (NR1H4)

Načítavanie...

Číslo patentu: E 18112

Dátum: 19.08.2010

Autori: Steeneck Christoph, Kremoser Claus, Kinzel Olaf, Abel Ulrich

MPK: A61K 31/443, A61K 31/42, A61K 31/4192...

Značky: viažúce, aktivitu, nr1h4, zlúčeniny, modulujúce, nové

Text:

...al. Fibroblast growth factor 15 functions as an enterohepatic signal to regulate bile acid homeostasis Cell Metab. 2005,2(4), 217-225).0009 Je tu jedna publikácia, ktorá navrhuje priamy vplyv aktivácie FXR na prežitie infekčných organizmov, ako sú baktérie alebo protozoálne parazity prostredníctvom zvýšenej regulácie lyzozomálneho zániku/faktor prežitia Taco-2 v makrofágoch (P. Anandet al. Downregulatíon of TACO gene transcription restricts...

Bišpecifické proteíny viažuce antigén

Načítavanie...

Číslo patentu: E 16073

Dátum: 14.06.2010

Autori: Regula Jörg Thomas, Schanzer Jürgen Michael, Klein Christian, Imhof-jung Sabine, Schaefer Wolfgang

MPK: C07K 16/46, C07K 16/22

Značky: antigen, viažúce, proteiny, bišpecifické

Text:

...reťazce) boli pozorované vysoké výťažky tvorby heterodiméru (knobho 1 e) oproti tvorbe homodiméru (hole-hole alebo knob-knob) (Ridgway, J .B., Protein Eng. 9 (1996) 617-621 a W 0 96/027011). Percento heterodiméru by sa mohlo ďalej zvýšiťprestavbou interakčných povrchov dvoch domén CH 3 za použitia metódy fágového displeja azavedením disulfidového mostíka za účelom stabilizácie heterodimérov (Merchant A.M, et al., Nature Biotech 16 (1998)...

Ľudské protilátky využívajúce a viažuce sa na lymfocytový aktivačný gén-3 (LAG-3)

Načítavanie...

Číslo patentu: E 18770

Dátum: 11.08.2009

Autori: Yamanaka Mark, Zens Kyra, Selby Mark, Korman Alan, Leblanc Heidi, Thudium Kent

MPK: C12N 5/16

Značky: ľudské, využívajúce, aktivačný, lymfocytový, viažúce, lag-3, gén-3, protilátky

Text:

...protilátok (najmä ľudských monoklonálnych protilátok) a antigénväzbových častí, ktoré špecificky viažu ľudský LAG-3 a zhŕňajú(a)ťažký reťazec premenlivého sekvenčného regiónu s minimálne95 zhodou aminokyselín podľa SEQ ID NO 37 a ľahký reťazecpremenlivého sekvenčného regiónu s minimálne 95 zhodouaminokyselín podľa SEQ ID NO 43.0006 Protilátky a taktiež antigén viažuce úseky patentu majú žiaduce funkčné vlastnosti. Tieto vlastnosti zahrňujú...

Výroba látok viažucich fosfát a týmto spôsobom vyrobené látky viažuce fosfát

Načítavanie...

Číslo patentu: E 13281

Dátum: 05.08.2009

Autori: Schlüter Andreas, Vestweber Anna-maria

MPK: A61K 9/20, A61K 31/19, A61K 9/16...

Značky: spôsobom, vyrobené, látky, fosfát, viažúce, látok, výroba, týmto, viažucich

Text:

...vylučovaním fosforu obličkami. Hyperfosfatêmia môže pritom spôsobovať následné problémy, ako je svrbenie (pruritus) alebo začervenané očné spojivky (konjunktivita). Spoločne s hyperkalcêmiou môže hyperfosfatémia okrem toho zvyšovať dráždivosť svalov a nervov, takže môže dochádzať k tetanickému syndrómu s poruchami hmatu a kŕčmi až do tetanického záchvatu.0011 Hyperfosfatémia je u osôb trpiacich insuficienciou obličiek často sprevádzaná...

Činidlá viažuce receptor Notch1 a spôsoby ich použitia

Načítavanie...

Číslo patentu: E 18086

Dátum: 08.07.2009

Autori: Gurney Austin, Axelrod Fumiko Takada, Bruhns Maureen Fitch, Hoey Timothy Charles

MPK: A61K 39/395, C07K 16/28

Značky: použitia, viažúce, notch1, spôsoby, receptor, činidla

Text:

...kmeňovým bunkám pevného tumoru (sebaobnova), tak i väčšinětumorových buniek pevného tumoru, ktorým chýba tumorigénny potenciál. Mutácie v populáciách dlho žijúcich kmeňových buniek skutočne môžu iniciovať tvorbu rakovinných kmeňových buniek, ktoré sú základom pre rast a udržiavanie tumorov, a ktorých prítomnosť sa podieľa na zlyhávaní súčasných liečebných postupov.0006 Objav, že podstatou rakoviny sú kmeňové bunky, sa najskôr učinil pri...

Molekuly viažuce sa na ľudský receptor OX40

Načítavanie...

Číslo patentu: E 15107

Dátum: 11.12.2008

Autori: Min Jing, Leblanc Heidi, Thiele Barrett Richard, Brams Peter, Huang Haichun, Finn Rory Francis, Rajpal Arvind, Gladue Ronald Paul, Wu Yi, Liao Wei, Devaux Brigitte, Toy Kristopher, Wu Yanli, Paradis Timothy Joseph

MPK: A61P 35/00, C07K 16/28

Značky: receptor, viažúce, ĺudský, molekuly

Text:

...spôsobom je spôsob zosilnenia imunitnej odozvy u cicavca. Vniektorých určitých uskutočneniach väzbovou molekulou používanou vmetódach podľa vynálezu je ľudská monoklonálna protilátka OX 40 R alebo jej fragment viažuci antigén.0007 Predmetný vynález ďalej opisuje molekuly nukleovej kyseliny, ktoré kódujú aminokyselinovú sekvenciu väzbovej moIekuIy, vektory obsahujúce takéto nukleové kyseliny, hostiteľské bunky obsahujúce vektory a spôsoby...

Zlepšené molekuly viažuce Nogo-A a ich farmaceutické použitie

Načítavanie...

Číslo patentu: E 14719

Dátum: 27.10.2008

Autori: Vitaliti Alessandra, Mir Anis Khurso, Schwab Martin, Barske Carmen, Frentzel Stefan

MPK: A61K 39/395, A61P 25/00, A61P 11/06...

Značky: nogo-a, použitie, molekuly, farmaceutické, zlepšené, viažúce

Text:

...rámcovými oblasťami, ktoré sú do veľkej miery v konformácii beta-skladaného listu. Oblasti CDR ťažkého reťazca spoločne s oblasťami CDR súvisiaceho (associated) ľahkého reťazca V zásade tvoria v molekule protilátky miesto víažuce antigén. Stanovenie, ktoré časti molekuly tvoria rámcovú oblasť a ktoré oblasť CDR, sa obvykle uskutočňuje pomocou porovnania sekvencie aminokyselín z radu protilátok vytváraných rovnakým druhom organizmu....

Protilátky viažuce sa na IL-4 a/alebo IL-13 a ich použitie

Načítavanie...

Číslo patentu: E 15812

Dátum: 14.10.2008

Autori: Rao Ercole, Mikol Vincent, Kruip Jochen, Davison Matthew, Li Danxi

MPK: A61P 35/00, A61K 39/395, A61P 11/06...

Značky: použitie, protilátky, il-13, viažúce

Text:

...Rd 1 viaže IL-4 aj IL-13 (Murata et al., Int. J. Hematol., 1999, 69, 13-20).0008 Imunitné odpovede typu Th 2 podporujú produkciu protilátok a humorálnu imunitu a sú vyvolané, aby čelili extracelulámym patogénom. Th 2 bunky sú sprostredkovateľmi produkcie lg(humorálna imunita) a produkujú IL-4, IL-5, IL-6, IL-9, IL-l 0 a IL-13 (Tanaka, et, al., Cytokine Regulation of Humoral Immunity, 251- 272, Snapper, Ed., John Wiley Sons, New York(1996....

Proteíny viažuce antigén rastového faktora podobné heparín viažucemu epidermálnemu rastovému faktoru

Načítavanie...

Číslo patentu: E 14993

Dátum: 26.09.2008

Autori: Zwick-wallasch Esther, Foord Orit, Rothe Mike, Borges Eric, Prenzel Norbert, Hettmann Thore

MPK: A61P 35/00, A61K 33/24, A61K 39/395...

Značky: rastovému, heparin, epidermálnemu, proteiny, antigen, viažucemu, faktora, faktoru, viažúce, rastového, podobně

Text:

...protilátkou alebo fragmentom protilátky, ako sú tu opisané, a určenie prítomnosti HB-EGF v uvedenej vzorke. V ďalšom aspekte stav je hyperproliferativne ochorenie súvisiace s expresiou HB-EGF.0020 Taktiež je tu oplsaný spôsob prevencie alebo liečby stavu súvisiaoeho s expresiou HB-EGF u pacienta,zahŕňajúci podávanie pacientovi ktorý až potrebuje. účinného množstva protilátky alebo fragmentu protilátkyako sú tu opísané. V ďalšom aspekte stav...

Činidlá viažuce Fc receptory konštantnej oblasti imunoglobulínu

Načítavanie...

Číslo patentu: E 20728

Dátum: 30.05.2008

Autori: Strome Scott, Schulze Dan, Block David, Olsen Henrik

MPK: A61K 39/395, A61P 43/00, C07K 16/00...

Značky: receptory, imunoglobulinů, viažúce, oblastí, činidla, konštantnej

Text:

...z oblastí obsahujúca najmenej jednu Fc doménu, ktoráje schopná viazať sa na Fcy receptor, obsahuje IgG 1 záves, IgG 1 CH 2 doménu a IgG 1 CH 3 doménu.0014 Tento vynález taktiež poskytuje kompozíciu, farmaceutickú kompozícíu akompozície na použitia ako sú definované v nárokoch.0015 Tento opis taktiež poskytuje mnoho uskutočnení vynálezu ako sú uvedené nižšie. Pokým ktorékoľvek z uskutočnení vynálezu je mimo nárokov, je ilustračné a časťou opisu...

Medzidruhovo-špecifické bišpecifické viažuce molekuly

Načítavanie...

Číslo patentu: E 12926

Dátum: 03.04.2008

Autori: Lutterbüse Ralf, Klinger Matthias, Kischel Roman, Rau Doris, Raum Tobias, Hoffmann Patrick, Kufer Peter, Mangold Susanne

MPK: C07K 16/28, C07K 14/705, C07K 16/30...

Značky: viažúce, bišpecifické, molekuly, medzidruhovo-špecifické

Text:

...zohrávajú hlavnú úlohu pri akútnom odmietnutí. OKT 3 reaguje s CD 3 komplexom v membránach ľudských T-buniek a blokuje jeho funkciu. CD 3 komplex súvisí s antigén-rozpoznávajúcou štruktúrou T-buniek (TCR) a je nevyhnutný pre signálnu transdukciu. Ktorá podjednotka TCR/CD 3 viaže OKT 3 je predmetom mnohých štúdii. Hoci niektoré výsledky poukázali na špeciñcim OKT 3 preTCR/CD 3 komplexu vyžaduje prítomnosť ďalších podjednotiek tohto komplexu...

Apoptotické anti-IGE protilátky viažuce sa na membránovo viazaný IGE

Načítavanie...

Číslo patentu: E 16636

Dátum: 21.03.2008

Autori: Wong Terence, Balazs Mercedesz, Wu Lawren, Chen Yvonne, Brightbill Hans, Chan Andrew, Chuntharapai Anan, Dennis Mark

MPK: A61P 37/06, A01K 67/027, C07K 16/42...

Značky: anti-ige, viažúce, viazaný, membránovo, protilátky, apoptotické

Text:

...antagonistu, ako je definované v nárokoch. V konkrétnej podobe kompozícia ďalej obsahuje najmenej jeden farrnaceuticky prijateľný nosič.0019 V zase inom uskutočnení vynálezu sa poskytuje izolovaná nukleová kyselina kódujúca ťažký reťazec HVR protilátky anti-IgE/M 1, ako je zobrazené na každom zObr. 6 A-6 F. ako je definované vnárokoch. V konkrétnej podobe obsahuje izolovaná nukleová kyselina dalej nukleovú kyselinu kódujúcu ľahký reťazec HVR...

Variantné látky viažuce cieľ a ich použitie

Načítavanie...

Číslo patentu: E 17754

Dátum: 01.12.2007

Autori: Carter Paul, Mcdonagh Charlotte, Sussman Django

MPK: A61K 39/395, A61K 47/48, A61K 51/10...

Značky: čiel, použitie, látky, viažúce, variantné

Text:

...A, G 237 A a E 318 A, ktoré vedú ku zhoršeniu FcyR väzby.Obrázok 6 znázorňuje väzbovú afinitu humanizovanej anti-CD 70 (h 1 F 6) a variantnej h 1 F 6 protilátky k bunkám 786-0 exprimujúcim CD 70. Každá protilátka (označená G 1, G 1 v 1, G 2, G 4 a G 4 v 3) bola redukovaná a označená maleimidom Alexa Fluor 488 C 5 (AF 488) a sériové riadenia bola inkubované s bunkami 786-0. Označené bunky boli detekované pomocou analyzátora LSRII FACS a dáta...

Proteíny viažuce IL-17 receptorový A antigén

Načítavanie...

Číslo patentu: E 18589

Dátum: 01.10.2007

Autori: Fitzpatrick David, Peschon Jacques, Lim Ai Ching, Smothers James, Mehlin Christopher, Tocker Joel

MPK: C07K 16/28

Značky: antigen, viažúce, il-17, proteiny, receptorový

Text:

...Laboratory Press, Cold Spring Harbor, N.Y. Pokial nie je uvedené inak, názvoslovie používané v súvislosti s tu opisanými Iaboratórnymi postupmi a metódami pre analytickú chémiu, organické chemické látky a medicínske a farmaceutické chemické látky je dobre známe a bežne používané v danej oblasti. Na chemickú syntézu, chemickú analýzu, farmaceutickú prípravu, formulovanie a dodávanie, ako aj na liečenie pacientov sa môžu používa štandardné...

Ľudské protilátky viažuce CXCR4 a ich použitie

Načítavanie...

Číslo patentu: E 20061

Dátum: 01.10.2007

Autori: Tanamachi Dawn, Brams Peter, Korman Alan, Cardarelli Josephine, Kuhne Michelle

MPK: A61K 39/395, C07K 16/28

Značky: protilátky, cxcr4, ľudské, použitie, viažúce

Text:

...s ECW na inhibíciu 50 nM alebo nižšiu, alebo 30 nM alebo nižšiu, alebo l 5 nM alebo nižšiu, alebo lOnM alebo nižšiu, alebo 5 nM alebo nižšiu, alebo 3 nM alebo nižšiu (napr. ECW na inhibíciu 28,60 nM alebo nižšiu, alebo 12,51 nM alebo nižšiu, alebo 2,256 nM alebo nižšiu). Vdalšom uskutočnení sa táto protilátka viaže na natívny ľudský CXCR 4 exprimovaný na povrchu bunky, avšak neinhibuje väzbu SDF-1 na ľudský CXCR 4. V ešte dalších...

Deriváty metotrexátu viažuce proteín a liečivá, ktoré ich obsahujú

Načítavanie...

Číslo patentu: E 7304

Dátum: 25.07.2007

Autori: Warnecke André, Kratz Felix

MPK: A61K 47/48, C07K 5/00, C07K 7/00...

Značky: viažúce, deriváty, proteín, obsahujú, metotrexátu, liečivá

Text:

...alebo reumaticky postihnutom tkanive MTX alebo deriváty MTX.0004 Úloha sa vyriešila pomocou foriem uskutočnenia uvedených0005 Predovšetkým sa pripravia deriváty metotrexátu všeobecnéhozosieťovadlo Peptĺd Spčceľ účinná látkaV ktorom R 1 H alebo CH 3, R 2 H alebo COOH, Pl-P 3 L- alebo D aminokyseliny, Xaa ozpustnosť poskytujúca aminokyselina, H O až 6, n O až 5, o O až 2, p l až 10 a PM je skupina viažuca proteín.0006 Podla...

Špecificky sa viažúce proteíny pre inzulínu podobné rastové faktory a ich využitie

Načítavanie...

Číslo patentu: E 12049

Dátum: 08.12.2006

Autori: Raeber Olivia, Yang Xiaodong, Tonge David William, Gazit-bornstein Gadi, Cartlidge Susan Ann

MPK: A61K 39/395

Značky: využitie, faktory, inzulínu, rastové, viažúce, specificky, proteiny, podobně

Text:

...hladiny IGFBP-3 sú asociované so zvýšeným rizikom vzniku niekoľkých bežných rakovín (prostaty,prsníka, kolorektálnej a pľúc) Mantzoros et al., Br. J. Cancer 7621115-1118 (1997) Hankinson et al., Lancet 3511393-1396 (1998) Ma et al., J. Natl.Cancer Inst. 912620-625 (1999) Karasik et al., J. Clin. Endocrinol Metab. 781271-276 (1994). Tieto výsledky naznačujú, že lGF-l a IGF-II pôsobia ako vplyvné mitogénne a antiapoptické signály a že ich...

Nádorovo asociované peptidy viažuce sa neselektívne na molekuly ľudského leukocytového antigénu (HLA) triedy II

Načítavanie...

Číslo patentu: E 6957

Dátum: 05.09.2006

Autor: Dengjel Jörn

MPK: A61K 39/00, C07K 14/435

Značky: hla, viažúce, nádorovo, leukocytového, ľudského, molekuly, asociované, peptidy, triedy, neselektívne, antigenů

Text:

...molekúl HLA triedy II sa obvykle obmedzuje na bunky imunitného systému (Mach,B., V. Steimle, E. Martinez-Soria a W. Reith. 1996. Regulation of MHC class II genes lessons from a disease. Annu. Rev. Immunol. 141301-331), možnosť priamej izolácie peptidov triedy II z primárnych nádorov za zdala nemožná. Boli preto popísané početné stratégie pre zaradenie tu popisovaných, predmetných antigénov do transformačnej dráhy triedy II...

Nádorovo asociované peptity viažuce sa neselektívne na molekuly ľudského leukocytového antigénu (HLA) triedy II

Načítavanie...

Číslo patentu: E 10791

Dátum: 05.09.2006

Autor: Dengjel Jörn

MPK: A61K 39/00, C07K 14/47

Značky: leukocytového, nádorovo, peptity, viažúce, hla, ľudského, antigenů, molekuly, neselektívne, triedy, asociované

Text:

...V. Steimle, E. Martinez-Seria a W. Reith. 1996. Regulation of MHC class II genes lessons3 from a dísease. Annu. Rev. Immunol. 142301-331), možnosť priamej izolácie peptidov triedy II z primárnych nádorov za zdala nemožná. Boli preto popísané početné stratégie pre zaradenie tu popisovaných, predmetných antigénov do transforrnačnej dráhy triedy II buniek prezentujúcich antigén (APCs), napríklad inkubácia APC daným antigénom tak, aby bol...

Nádorovo asociované peptidy viažuce sa na molekuly ľudského leukocytového antigénu (HLA) triedy I alebo II a súvisiaca protirakovinová vakcína

Načítavanie...

Číslo patentu: E 8984

Dátum: 05.09.2006

Autori: Emmerich Niels, Weinschenk Toni, Singh Harpreet, Walter Steffen

MPK: A61K 38/00, A61K 39/00, C07K 14/47...

Značky: hla, asociované, molekuly, protirakovinová, súvisiaca, nádorovo, viažúce, peptidy, vakcína, triedy, antigenů, ľudského, leukocytového

Text:

...Komplexy peptidu a MHC I sú rozpoznávané CD 8-pozitivnymi cytotoxickými T-lymfocytmi, komplexy peptidu a MHC-Iľ zasa CD 4-pozitívnymi pomocnými T bunkami.CD 4-pozitívne pomocné T-bunky zohrávajú dôležitú úlohu pri koordinácii súčinnosti efektorových funkcii odoziev protinádorových T~buniek a z tohto dôvodu môže byť identifikácia CD 4-pozitívnych epitópov T-buniek odvodených od nádorových antigenov (TAA) veľmi dôležitá pri vývoji...

IL-1beta viažuce protilátky a ich fragmenty

Načítavanie...

Číslo patentu: E 6721

Dátum: 21.06.2006

Autori: Roell Marina, Horwitz Arnold, Cheng Gang, Masat Linda, Haak-frendscho Mary

MPK: A61K 39/395, A61P 37/00, C07K 16/00...

Značky: protilátky, il-1beta, fragmenty, viažúce

Text:

...tu opísaných, ako je protilátka označená ako AB 7, ktorá obsahuje variabilnú oblasť ťažkého reťazca. Okrem toho môžu IL-IB viažuce protilátky alebo lL-B viažuce fragmenty súťažiť s väzbou protilátky obsahujúcou variabilnú oblasť ľahkého reťazca so SEKV. ID. Č. ll a variabilnú oblasť ťažkého reťazca so SEKV. ID. Č. 15. Okrem toho predkladaný vynález zahŕňa IL-IB viažuce protilátky alebo IL-IB viažuce fragmenty,ktoré sa môžu viazat na epitop...

IL-1 beta viažuce protilátky a ich fragmenty

Načítavanie...

Číslo patentu: E 12549

Dátum: 21.06.2006

Autori: Horwitz Arnold, Roell Marina, Haak-frendscho Mary, Chen Gang, Masat Linda

MPK: C07K 16/00, A61K 39/395, A61P 37/06...

Značky: fragmenty, viažúce, protilátky

Text:

...rámci predkladaného vynálezu sa opisuje spôsob prípravy zhľadiska atinity zrclćho, IL-lB viažuceho polypeptidu, zahŕňajúci (a) zaobstaranie prvej nukleovej kyseliny obsahujúcej sekvenciu nukleovej kyseliny kódujúcu IL-IB viažuci polypeptid, ktorý obsahuje ktorúkoľvek aminokyselinovú sekvenciu zo SEKV. ID. Č. 1-26, a druhej nukleovej kyseliny obsahujúcej sekvenciu nukleovej kyseliny, ktorá sa liší od sckvencic prvej nukleovej kyseliny aspoň...

IL-1 beta viažuce protilátky a ich fragmenty

Načítavanie...

Číslo patentu: E 15665

Dátum: 21.06.2006

Autori: Masat Linda, Horwitz Arnold, Chen Gang, Haak-frendscho Mary, Roell Marina

MPK: C07K 16/00, A61P 37/06, A61K 39/395...

Značky: protilátky, fragmenty, viažúce

Text:

...aspoň jedným nukleotidom, (b) uskutočnenie preslcupenia (shuffling) nukleovej kyseliny za zisku dvoch alebo viacerých mutovaných nukleových kyselín, (c) výber mutovanej nukleovej kyseliny, ktorá kóduje polypeptid, ktorý (i) sa viaže na IL-lB s vyššou aflnitou než polypeptid kódovaný prvou nukleovou kyselinou, (ii) vykazuje selektivitu pre IL-IB oproti lL-la, ktorá je vyššia než selektivita polypeptidu kódovaného prvou nukleovou kyselinou,...

IL-1 beta viažuce protilátky a ich fragmenty

Načítavanie...

Číslo patentu: E 20849

Dátum: 21.06.2006

Autori: Horwitz Arnold, Roell Marina, Chen Gang, Haak-frendscho Mary, Masat Linda

MPK: A61K 39/395, A61P 37/06, C07K 16/00...

Značky: protilátky, fragmenty, viažúce

Text:

...typu I. Okrem toho sa IL-lB viažuce protilátky alebo IL-lB viažuce fragmenty môžu viazať na v podstate rovnaký epitop ako jedna alebo viaceré z prikladných protilátok tu opísaných ako je protilátka označená ako AB 7, ktorá obsahuje variabilnú oblasť ťažkého reťazca. Okrem toho IL-IB viažuce protilátky alebo IL-13 viažuce fragmenty súťažia s väzbou protilátky obsahujúcou variabilnú oblasť ľahkého reťazca so SEKV. ID. Č. 11 a variabilnú...

Protilátky viažuce TWEAK

Načítavanie...

Číslo patentu: E 17123

Dátum: 25.05.2006

Autori: Garber Ellen, Lugovskoy Alexey, Burkly Linda

MPK: C07K 16/28, A61K 39/395, A61P 35/00...

Značky: tweak, viažúce, protilátky

Text:

...IgG 1 (napr. humánny IgG 1). Typicky je konštantné oblasť ťažkého reťazca humànna alebo je to modifikovanà forma humánnej konštantnej oblasti. V ďalšom uskutočnení sa konštantná oblast ľahkého reťazca vyberá napr. z kappa alebo Iambda, najmä kappa0010 Protein môže zahŕňať jednu z nasledujúcich sekvencllDIVMTQTPLSLPVTPGEPASISCRSSQSLVSSKGNTYLHWYLQKPGQSP QLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCSQSTH FPRT (SEQ ID...

Proteíny viažuce sérový albumín

Načítavanie...

Číslo patentu: E 11376

Dátum: 17.05.2006

Autori: Beirnaert Els, Hoogenboom Hendricus Renerus Jacobus Mattheus, Revets Hilde Adi Pierette

MPK: C07K 19/00, C07K 16/18

Značky: sérový, viažúce, albumín, proteiny

Text:

...s molekulou sérového albumínu nebola väzbatejto molekuly sérového albumínu na FcRn (významne) znížená alebo inhibovaná (t.j. vporovnaní s väzbou tejto molekuly sérového albumínu na FcRn, ked na nej aminokyselinová sekvencía alebo polypeptidový konštmkt nie je viazaný). V tomto aspekte tohto vynálezu sa nie významným znížením alebo ínhibíciou mieni to, že sa väzbová añníta sérového albumínu na FcRn (meraná pomocou vhodného testu, napr....

Sklerostín viažuce prostriedky

Načítavanie...

Číslo patentu: E 18856

Dátum: 28.04.2006

Autori: Latham John, Lu Hsieng Sen, Winters Aaron George, Henry Alistair James, Robinson Martyn Kim, Winkler David, Hoffmann Kelly Sue, Lawson Alastair, Popplewell Andy, Graham Kevin, Paszty Christopher, Shen Wenyan

MPK: A61K 38/17, C07K 14/51, A61K 38/10...

Značky: viažúce, prostriedky, sklerostín

Text:

...2001). Sekvencia aminokyselín ľudského sklerostínu je uvádzaná autormiBrunkow a kol. tamtiež a je tu opísaná ako SEQ lD N 021. WO 2005/014650 opisuje protilátky špecifické pre sklerostín a spôsoby na zvyšovanie mineralizácie kostí.0007 Sú tu opísané prostriedky, ktoré je možné použiť na zvyšovanie aspoň jedného ztvorby kostí, hustoty kostných minerálov, obsahu kostných minerálov,kostnej hmoty, kvality kostí a pevnosti kostí, a ktoré je...

Sklerostín viažuce prostriedky

Načítavanie...

Číslo patentu: E 14733

Dátum: 28.04.2006

Autori: Shen Wenyan, Paszty Christopher, Winters Aaron George, Lawson Alastair, Robinson Martyn Kim, Hoffmann Kelly Sue, Henry Alistair James, Winkler David, Lu Hsieng Sen, Graham Kevin, Latham John, Popplewell Andy

MPK: C07K 16/18, C07K 14/51

Značky: sklerostín, prostriedky, viažúce

Text:

...2001). Sekvencia aminokyselín ľudského sklerostínu je uvádzaná autormi Brunkow a kol. tamtiež a je tu opísaná ako SEQ ID NO 1.0007 Sú tu opísané prostriedky a spôsoby, ktoré je možné použiť na zvyšovanie aspoň jedného z tvorby kostí, hustoty kostných minerálov, obsahu kostných minerálov, hmoty kostí, kvality kostí a pevnosti kostí, a ktoré je teda možné použit na liečbu širokej škály stavov, v ktorých je žiaduci nárast aspoň...

Činidlá viažuce KIR a spôsoby ich použitia

Načítavanie...

Číslo patentu: E 13432

Dátum: 06.01.2006

Autori: Spee Pieter, Zahn Stefan, Wagtmann Peter Andreas Nicolai Reumert, Kjärgaard Kristian, Svensson Anders, Padkar Sören Berg

MPK: A61K 39/395, A61P 31/00, A61P 35/00...

Značky: činidla, viažúce, použitia, spôsoby

Text:

...rozpoznávajú molekuly triedy I hlavného319 675-8 öhlén a spol. Science 1989 246 666-8.). Tieto inhibičné receptory sa viažu na polymorfné determinanty MHC molekúl triedy I (zahŕñajúce HLA triedu I) prítomné na inýchbunkách a inhibujú lýzu sprostredkovanú NK bunkami.0006 KIR boli charakterizované u ľudských a neľudských primátov a sú to trans-membránové molekuly polymorfného typu 1 na istých podradoch lymfocytov, zahŕñajúce NK bunky a...

Nádorovo asociované peptidy viažuce sa neselektívne na molekuly ľudského leukocytového antigénu (HLA) triedy II

Načítavanie...

Číslo patentu: E 7407

Dátum: 05.09.2005

Autor: Dengjel Jörn

MPK: A61K 39/00, C07K 14/435

Značky: molekuly, triedy, nádorovo, asociované, viažúce, antigenů, ľudského, leukocytového, neselektívne, peptidy, hla

Text:

...a imunizovaní nádorov voči nádorovému antigénu opičicho vírusu 40. Cancer Ras. 63 1040-1045). Na rozdiel od nádorovo asociovaných peptidov viažucich sa na HLAmolekuly triedy I. bolo doteraz popísanycli iba málo ligandov TAA triedy ll(wwwcancerimmunitybrg, wwwsytpeithilde). Pretože základná exprimácia molekúl HLA triedy 11 sa obvykle obmedzuje na bunky imunítného systému (Mach, B., V. Steímle, E. Martinez-Soria a W. Reith. 1996. Regulation...

Nádorovo asociované peptidy viažuce sa neselektívne na molekuly ľudského leukocytového antigénu (HLA) triedy II

Načítavanie...

Číslo patentu: E 7406

Dátum: 05.09.2005

Autor: Dengjel Jörn

MPK: C07K 14/435, A61K 39/00

Značky: leukocytového, molekuly, asociované, antigenů, viažúce, triedy, hla, nádorovo, peptidy, neselektívne, ľudského

Text:

...triedy I, bolo doteraz popísaných iba málo ligandov TAA triedy ll(wwweancerimmunityorg, www.syfpeithi.de). Pretože základná exprimácia molekúl HLA triedy ll sa obvykle obmedzuje na bunky imunitného systému (Mach, B., V. Steimle, E. Martinez-Soria a W. Reith. 1996. Regulation of MHC class II genes lessons from a disease. Annu. Rev. lmmzmol. l 430 l-331), možnost priamej izolácie peptidov triedy ll z primámych nádorov za zdala nemožná. Boli...

Nádorovo asociované peptidy viažuce sa na molekuly ľudského leukocytového antigénu (HLA) triedy I alebo II a súvisiaca protirakovinová vakcína

Načítavanie...

Číslo patentu: E 6338

Dátum: 05.09.2005

Autori: Singh Harpreet, Walter Steffen, Weinschenk Toni, Emmerich Niels

MPK: C07K 14/435, A61K 38/00, A61K 39/00...

Značky: nádorovo, hla, triedy, vakcína, peptidy, molekuly, ľudského, súvisiaca, antigenů, protirakovinová, asociované, leukocytového, viažúce

Text:

...Correlation with antibodyNa zvieracích cicavčích modeloch, napr. na myšiach, bolo preukázané, že aj za neprítomnosti efektorových cytotoxických T-lymfocytov buniek (CTL) (t.j. CD 8-pozitívnych T-lymfocytov),CD 4-pozitivne T-bunky postačujú na potlačenie vizualizácie nádorov inhibovanim vylučovania interferónu gama (IFNV) (Qin,Z. a T. Blankenstein. 2000. CD 4 T-cell-mediated tumor rejection involves inhibition of angiogenesis that is dependent...

Peptidy spojené s nádorom viažuce sa neselektívne na molekuly ľudských leukocytových antigénov triedy II

Načítavanie...

Číslo patentu: E 3551

Dátum: 05.09.2005

Autor: Dengjel Jörn

MPK: C07K 14/435, A61K 39/00

Značky: peptidy, triedy, nádorom, antigénov, spojené, molekuly, neselektívne, leukocytových, viažúce, ľudských

Text:

...1996. Regulation of MHC class IIgenes lessons from adisease. Annu. Rev. Immunol. 142301-331), možnosť priamej izolácie peptidov triedy II z primámych nádorov sa zdala nemožné. Boli preto opisané početné stratégie na zaradenie tu opisovaných, predmetných antigénov do transformačnej dráhy triedy II buniek prezentujúcich antigén (APCs), napríklad inkubácia APC s daným antigénom tak, aby bol prevzatý, spracovaný a prezentovaný (Chaux, P., V....

S nádorom asociované peptidy viažuce sa na molekulu MHC

Načítavanie...

Číslo patentu: E 6638

Dátum: 24.05.2005

Autori: Rammensee Hans Georg, Weinschenk Toni, Stevanovic Stefan, Lemmel Claudia

MPK: C07K 14/435, C07K 7/00

Značky: asociované, peptidy, molekulu, viažúce, nádorom

Text:

...alebo boli V takýchto tkanivách selektívne exprimované,neposkytuje však žiadnu precíznu informáciu pre imunoterapeutické použitie antigénov transkribovaných týmito génmi. To je dôsledok toho, že pre takéto použitie sa vždy hodia len jednotlivé epitopy týchto antigénov, pretože sú to iba epitopy antigénov - a nie celý antigén, ktoré prezentáciouMHC vyvolávajú reakciu T-buniek. Preto je dôležité oddeliť od nadexprimovaných alebo selektívne...

S nádorom asociované peptidy viažuce sa na molekulu MHC

Načítavanie...

Číslo patentu: E 12077

Dátum: 24.05.2005

Autori: Rammensee Hans Georg, Stevanovic Stefan, Trautwein Claudia, Weinschenk Toni

MPK: C07K 14/47, C07K 7/06

Značky: molekulu, viažúce, nádorom, peptidy, asociované

Text:

...špecifické rozpoznanie primárnych buniek alebo etablovaných línií nádorových buniek zprimárnych buniek nádorového tkaniva cytotoxickými Tlymfocytmi.DE 102 25 144 A 1 manifestuje identifikáciu s nádorom asociovaných peptidov ináč, ako SEQ ID č. 303, ktoré sa vyznačujú schopnosťou víazat sa na molekulu ľudského MHC triedy I.Pluschke et al. (v Pluschke et al., Molecular Cloning of a human melanoma-associated chondroitin sulfate proteoglycan...

Multišpecifické deimunizované molekuly viažuce sa k CD3

Načítavanie...

Číslo patentu: E 9076

Dátum: 15.10.2004

Autori: Bäuerle Patrick, Williams Stephen, Hamilton Anita, Itin Christian, Kohleisen Birgit, Hofmeister Robert, Lenkkeri-schütz Ulla, Carr Francis

MPK: C07K 16/28, C12N 15/13, A61K 39/395...

Značky: multišpecifické, molekuly, viažúce, deimunizované

Text:

...čo vedie k produkcii ľudských anti-myších protilátok (HAMA)(Schroff (1985) Cancer Res. 45 879-885, Shawler (1985) J. lmmunol. 135 1530-1535). HAMA sú typicky vytvárané počas druhého týždňa liečenia myšou protilátkou a neutralizujú myšie protilátky, čím blokujú ich schopnosť viazat sa k ich zamýšľanému cieľu. HAMA reakcia môže závisiet od myších konštantných(Fc) protilátkových oblastí alebo/a povahy myších premenných (V) oblastí.0007 Doterajší...

Polypeptydové kompozície viažuce CD20

Načítavanie...

Číslo patentu: E 8154

Dátum: 16.08.2004

Autori: Gillies Stephen, Williams Stephen, Carr Francis

MPK: A61P 35/00, C07K 14/55, A61K 39/395...

Značky: viažúce, kompozície, polypeptydové

Text:

...podľa predkladaného vynálezu, a to monoklonálnu protilátku 2 B 8 (Reff, M.E. et al. (1994) Blood 83 435-445).Variabilné oblasti domény 2 B 8 boli klonované a kombinované s doménami humánnej konštantnej oblasti za vzniku chimérickej protilátky nazvanj C 2 B 8, ktorá je na trhu ako RITUXANTM V USA alebo MABTHERA® (rituxímab) v Európe. C 2 B 8 je považovaný za cenné terapeutické činidlo pre liečbu NHL a ďalších chorôb B lymfocytov (Maloney,...

Molekuly viažuce antigén CD20

Načítavanie...

Číslo patentu: E 10242

Dátum: 20.05.2004

Autori: Watkins Jeffry, Allan Barrett, Marquis David, Davies Julian, Ondek Brian

MPK: A61P 35/00, A61P 31/00, A61K 39/395...

Značky: antigen, viažúce, molekuly

Text:

...antigénu CD 20. Molekuly podľa predloženého vynálezu viažuce antigén CD 2 O výhodne obsahujú variabilné oblasti ľahkého a/alebo ťažkého reťazca splne ľudskými rámcami(napr. ľudskými zárodočnými konzervatívnymi oblasťami).0008 Vniektorých uskutočneniach predložený vynález poskytuje kompozície obsahujúce molekulu viažucu antigén CD 20. Táto molekula obsahuje a) variabilnú oblasť ľahkého reťazca alebo časť variabilnej oblasti ľahkého reťazca,...