C07K 14/47

Izolovaná protilátka alebo fragment protilátky, ktoré sa špecificky viažu na RG1 polypeptid, a imunokonjugát


Číslo patentu: 288147

Dátum: 13.11.2013

Autori: Schneider Douglas, Parry Gordon, Steinbrecher Renate, Harkins Richard, Parkes Deborah

MPK: A61K 38/17, A61K 45/00, A61K 39/395...

Značky: viažu, imunokonjugát, izolovaná, fragment, protilátka, polypeptid, specificky, protilátky

Zhrnutie / Anotácia:

Vynález sa týka izolovanej protilátky alebo fragmentu protilátky, ktoré sa špecificky viažu na RG1 polypeptid, na použitie ako liečivo. Protilátkou je polyklonálna alebo monoklonálna protilátka. Fragment protilátky je zvolený zo skupiny pozostávajúcej z Fv, F(ab') a F(ab')2 fragmentov. Vynález sa ďalej týka imunokonjugátu obsahujúceho izolovanú protilátku alebo fragment protilátky, ktoré sa špecificky viažu na RG1 polypeptid, ktoré sú spojené s...

Molekula mutantu CTLA4 alebo nukleovej kyseliny, vektor a hostiteľský vektorový systém, hostiteľská bunka, proteín mutantu CTLA4, spôsob jeho prípravy a použitie, farmaceutická kompozícia a spôsob regulácie


Číslo patentu: 288131

Dátum: 16.09.2013

Autori: Bajorath Jurgen, Linsley Peter, Naemura Joseph, Peach Robert

MPK: A61P 37/00, A61K 38/16, A61K 45/00...

Značky: farmaceutická, nukleovej, regulácie, kyseliny, mutantů, použitie, přípravy, spôsob, systém, buňka, hostiteľský, ctla4, kompozícia, hostiteľská, proteín, molekula, vektorový, vektor

Zhrnutie / Anotácia:

Je opísaná molekula mutantu CTLA4, molekula nukleovej kyseliny, ktorá zahŕňa nukleotidovú sekvenciu kódujúcu aminokyselinovú sekvenciu korešpondujúcu s molekulou mutantu CTLA4, vektor obsahujúci sekvenciu nukleovej kyseliny, hostiteľský vektorový systém obsahujúci vektor, hostiteľská bunka majúca uvedený vektor, spôsob prípravy proteínu mutantu CTLA4, proteín mutantu CTLA4 pripraveného uvedeným spôsobom, farmaceutická kompozícia, ktorá obsahuje...

V podstate čistý alebo rekombinantný polypeptid, nukleová kyselina, hostiteľská bunka, spôsob výroby polypeptidu, väzobná zlúčenina, kit, zmes obsahujúca protilátku a jej použitie


Číslo patentu: 287984

Dátum: 30.07.2012

Autori: Kastelein Robert, Chirica Madaline, Moore Kevin, Parham Christi

MPK: A61K 38/17, A61K 39/395, A61K 45/06...

Značky: rekombinantný, spôsob, zlúčenina, obsahujúca, kyselina, nukleová, polypeptid, výroby, polypeptidů, väzobná, čistý, podstatě, použitie, hostiteľská, protilátku, buňka

Zhrnutie / Anotácia:

Nukleové kyseliny kódujúce cicavčie, napr. primátové receptory, purifikované receptorové proteíny a ich fragmenty. Poskytnuté sú protilátky, tak polyklonálne, ako aj monoklonálne. Opísané sú spôsoby použitia prostriedkov, tak na diagnostické, ako aj na terapeutické využitia.

Inhibítory apoptózy a ich použitie


Číslo patentu: E 19743

Dátum: 17.11.2011

Autori: Lebleu Bernard, Nargeot Joël, Piot Christophe, Boisguerin Prisca, Barrere Stéphanie

MPK: C07K 14/47

Značky: inhibitory, použitie, apoptózy


...a farmaceutické kompozície podľa vynálezu používajú v spôsobe na liečenie ischémie, najmä srdcovej ischémie, ischémie obličiek,ischemickej kolitídy, mezenterickej ischémie, mozgovej ischémie, ischémie končatín alebo kožnej ischémie v ľudskom alebo zvieracom tele.0022 V ešte ďalších uskutočneniach sa peptidy, peptidomimetika, konjugáty a farmaceutické kompozície podľa vynálezu používajú v spôsobe liečby reperfúzneho poškodenia ľudského...

Peptidy odvodené od p16INK4a na profylaxiu a liečenie nádorov súvisiacich s HPV a ďalších p16INK4a exprimujúcich nádorov


Číslo patentu: E 20273

Dátum: 21.09.2011

Autori: Kloor Matthias, Reuschenbach Miriam, Knebel-doeberitz Magnus

MPK: A61K 39/00, C07K 16/08, C07K 14/47...

Značky: odvodené, profylaxiu, exprimujúcich, p16ink4a, dalších, súvisiacich, peptidy, nádorov, liečenie


...opraveného prekladu SLOVENSKEJ REPUBLIKY patentového spisu 08/2016 Číslo pôvodnej prihlášky v prípade vylúčenej prihlášky Číslo podania medzinárodnej prihlášky podľa PCT Číslo zverejnenia medzinárodnej prihlášky podľa PCT(74) Zástupca inventa Patentová a známková kancelária s.r.o., Palisády 50, 811 06 Bratislava, SKPeptidy odvodené od p 16 INK 4 a na profylaxiu a liečenie nádorov súvisiacich s HPV a ďalších p 16 INK 4 a N exprimujúcích...

Použitie dlhého pentraxin PTX3 alebo jeho funkčných derivátov alebo domén na prípravu liečiva


Číslo patentu: 287791

Dátum: 16.09.2011

Autori: Mantovani Alberto, Rusnati Marco, Botazzi Barbara, Presta Marco

MPK: A61P 17/06, A61K 38/17, A61P 35/00...

Značky: použitie, funkčných, přípravu, pentraxin, liečivá, domén, derivátov, dlhého

Zhrnutie / Anotácia:

Opísané je použitie dlhého pentraxin PTX3 (PTX3) alebo jeho funkčných derivátov alebo domén na prípravu liečiva, ktoré inhibuje biologickú aktivitu rastového faktora FGF-2, pričom uvedené liečivo je použiteľné pri prevencii a liečbe chorôb vyvolaných zmenenou aktiváciou uvedeného rastového faktora FGF-2.

Použitie L-karnitínu ako stabilizačného činidla proteínov


Číslo patentu: 287787

Dátum: 30.08.2011

Autor: Calvani Menotti

MPK: A61K 31/14, A61K 31/205, A61P 27/02...

Značky: použitie, činidla, stabilizačného, proteínov, l-karnitinu

Zhrnutie / Anotácia:

Je opísané použitie L-karnitínu a jeho solí na zachovanie aktivity zmeneného chaperónového proteínu alfa-kryštalínu.

Analógy peptidu-1 podobného glukagónu


Číslo patentu: 287757

Dátum: 27.07.2011

Autori: Millican Rohn Lee, Glaesner Wolfgang

MPK: A61K 38/26, A61P 1/04, A61K 38/00...

Značky: podobného, glukagónu, analogy, peptidu-1

Zhrnutie / Anotácia:

Sú opísané GLP-1 zlúčeniny obsahujúce sekvenciu aminokyselín SEQ ID NO: 1, SEQ ID NO: 2 alebo SEQ ID NO: 3 na použitie ako liečivo na liečenie od inzulínu nezávislého diabetu, na profylaktické ošetrenie od inzulínu nezávislého diabetu alebo na použitie na liečenie obezity, mŕtvice, infarktu myokardu, katabolických pooperačných zmien alebo syndrómu dráždivého čreva.

Frataxínové mutanty


Číslo patentu: E 20151

Dátum: 27.07.2011

Autor: Testi Roberto

MPK: C07K 14/47

Značky: frataxínové, mutanty


...zvyšuje hladiny frataxinu neznámym mechanizmom (W 0 2006/050819). Rekombinantný erytropoietin na liečenie FRDA je V súčasnosti v II fáze klinického testovania.0005 Napriek mnohým použitým. prístupom na liečenie FRDA sa ukázalo, že tieto prístupy majú významné obmedzenia. Preto naďalej existuje potreba nových spôsobov pre účinnejšie liečenie0006 Predkladaný vynález je adresovaný na dlhodobé potreby V oblasti medicíny a poskytuje nové...

Sérové amyloidové P deriváty a ich príprava a použitie


Číslo patentu: E 19929

Dátum: 04.06.2010

Autori: Willett Scott, Caimi Richard

MPK: A61P 29/00, A61K 38/17, C07K 14/47...

Značky: sérové, amyloidové, použitie, deriváty, príprava


...amínokyselinovou sekvenciou SEKV ID č. 1.3. Glykozylovaného ľudského SAP polypeptidu podľa bodu l alebo 2, pričom N-viazaný oligosacharidový reťazec zahŕňa pentasacharidové jadro Man(u 1,6)-(Man(o.1,3)Man(B 1,4)-GlcNAc(B 1,4)-GlcNAc(l 3 l,N)-Asn.4. Glykozylovaného ľudského SAP polypeptidu podľa ktoréhokoľvek z bodov 1-3, pričomoligosacharidový reťazec zahŕňa aspoň jednu vetvu, ktorá má štruktúru NeuNAc 2 a 3 Gall 34 GIcNAcl 52 Mana 6.5....

Biologické látky a ich použitie


Číslo patentu: E 16836

Dátum: 15.03.2010

Autori: Midwood Kim Suzanne, Foxwell Brian Maurice John

MPK: C07K 14/78, C07K 16/18, C07K 14/47...

Značky: látky, biologické, použitie


...tenascínu-C tiež významne stúpajú v synoviálnej tekutine upacientov s RA(Chevalier (1994) a Hasegawa (2007 a pri RA chrupavkách (Salter (1993) a Chevalier0010 Tenascín-C je veľký hexarnémy proteín s veľkosťou 1,5 milióna Da. Každý reťazec obsahuje rozdielne domény, ktoré obsahujú spojovaciu doménu (assembly domain, TA),repetície podobné EGF (EGF-L), repetície fibronektínového typu III (ñbronectin type IIIlike repeats, TNIII) a...

Prípravok na prevenciu a liečbu neurodegeneratívnych ochorení


Číslo patentu: E 20837

Dátum: 09.03.2010

Autori: Shaltiel-karyo Ronit, Gazit Ehud

MPK: C07K 14/47, G01N 33/68, A61K 38/17...

Značky: prevenciu, neurodegeneratívnych, liečbu, ochorení, prípravok


...prsníka, vaječníkov a tkaniva mechúra. Sekvencia troch synukleínov je vysoko konzervovaná, a to najmä v ich N-terminálnej doméne. Pri porovnaní sekvenciíalfa-syn a beta-syn je hlavný rozdiel V hydrofóbnejcentrálnej doméne beta-syn, 134 aminokyselinový proteín,postráda oblasť NAC alfa-syn a neagreguje za vzniku amyloidných fibríl počas rôznych stresových podmienok, ako sú voľné radikály alebo zvýšená koncentrácia.0004 V prípade rôznych...

Nové a silné peptidy triedy II MHC odvodené zo survivínu


Číslo patentu: E 19541

Dátum: 14.05.2009

Autori: Gouttefanges Cécile, Stevanovic Stefan, Weinschenk Toni, Rammensee Hans Georg, Lewandrowski Peter

MPK: C07K 14/47, A61K 38/00, C07K 16/18...

Značky: silně, triedy, peptidy, nové, odvodené, survivínu


...embryonálneho tkaniva. Celkový ročný výskyt primámych nádorov mozgu v3 Spojených štátoch je 14 prípadov na 100 000 osôb. Najčastejšie primárne nádory mozgu sú meningiómy, ktoré predstavujú 27 všetkých primárnych nádorov mozgu, a glioblastómy,ktoré predstavujú 23 všetkých primárnych nádorov mozgu (zatiaľ čo glioblastómy predstavujú 40 malígnych nádorov mozgu u dospelých). Mnohé ztýchto nádorov sú agresívne a ich stupeň je vysoký....

Kompozície a spôsoby použitia pro-ostovčekových peptidov a ich analógov


Číslo patentu: E 18717

Dátum: 29.08.2008

Autori: Garsky Victor, Levetan Claresa, Upham Loraine Veal

MPK: A61K 38/22, A61K 38/26, C07K 14/47...

Značky: pro-ostovčekových, kompozície, peptidov, spôsoby, analógov, použitia


...cukrovky.0011 V ďalšom uskutočnení, môžu byť použité peptidy na liečenie patológie spojenej so zoslabenou funkciou pankreasu u subjektu, ktorý potrebuje takéto liečenie. Tiež je opísaný spôsob zahmujúci okrem podania optimalizovaných pro-ostrovčekových peptidových zlúčenín, vrátane optimalizovanéhoHlP, krok podania jedného alebo viacerých činidiel, ktoré inhibujú, blokujú alebo ničia autoimunitné bunky, ktoré sú zacielené na pankreatické...

Protilátky proti properdínu


Číslo patentu: E 19029

Dátum: 27.06.2008

Autor: Bansal Rekha

MPK: C07K 14/47, C07K 14/00, C07K 16/00...

Značky: proti, protilátky, properdínu


...Polyklonálne protilátky vytvorené proti TSRS dokladajú, že TSRS sa podieľa na väzbe C 3 b a aktivácii altematívnej cesty (Perdikoulis, M.V., U. Kíshore a K.B. Reid, Expression and characterisation of the thrombospondin type l repeats of human properdin, Biochim Biophys Acta, 2001. l 548(2) str. 265 - 77). Hoci inhibícia väzby P a hemolýzy týkajúca sa alternatívnej cesty činila len 40 - 50 , autori uvedeného dokumentu sa domnievajú, že oblasť...

CDCA1 peptid a farmaceutický prostriedok obsahujúci tento peptid


Číslo patentu: E 18719

Dátum: 13.06.2008

Autori: Harao Michiko, Nishimura Yasuharu, Tsunoda Takuya, Nakamura Yusuke

MPK: A61K 39/00, A61K 35/12, A61K 38/00...

Značky: obsahujúci, prostriedok, farmaceutický, cdca1, peptid


...by mohla účinne eliminovať iba rakoviny, bez toho aby spôsobila nejakú nežiaducu udalosť pri normálnych autológnych orgánoch. Tiež sa predpokladá, že táto terapia sa môže použiť pre akýchkoľvekpacientov s terininálnou rakovinou, u ktorých nie je možné aplikovať iné liečenie. Navyše, podaním vopred antigénu a peptidu špecifického pre rakovinu vo forme vakcíny jedincom s vysokým rizikom rozvoja rakovin, sa môže predchádzať rozvoju rakoviny.Aj...

Lyofilizovaná zmes WT-1 obsahujúca CpG


Číslo patentu: E 13102

Dátum: 22.05.2008

Autor: Lemoine Dominique

MPK: C07K 14/47, A61K 39/00

Značky: obsahujúca, lyofilizovaná


...ktorý je stabilnejšíako je len jednoduché pridanie imunostimulačného olígonukleotidu obsahujúceho CpG do tekutej formulácie MPL a QS 21.-3 0018 Predkladaný vynález poskytuje výhodu, že tam, kde antigén a imunostimulačný oligonukleotid obsahujúci CpG sa rekonštituuje s WFI. je možné poskytnúť len jednu fľaštičku obsahujúcu Iyoñlizovanú formuláciu. Navyše tam, kde WT-1 alebo jeho derivát alebo fragment a imunostimulačný oligonukleotid obsahujúci...

Peptidy, nukleové kyseliny a bunky na použitie v imunoterapeutických metódach


Číslo patentu: E 17957

Dátum: 14.05.2008

Autori: Gouttefanges Cécile, Stevanovic Stefan, Rammensee Hans Georg

MPK: A61K 38/00, C07K 14/47, C07K 16/18...

Značky: imunoterapeutických, buňky, nukleové, metódach, kyseliny, peptidy, použitie


...embryonálneho tkaniva. Celkový ročný výskyt primámych nádorov mozgu v Spojených štátoch je 14 prípadov na 100 000 osôb. Najčastejšie primárne nádory mozgu sú meningiómy, ktoré predstavujú 27 všetkých primárnych nádorov mozgu a glioblastómy,ktoré predstavujú 23 všetkých primárnych nádorov mozgu (zatiaľ čo glíoblastómy predstavujú 40 malígnych nádorov mozgu u dospelých). Mnohé ztýchto nádorov sú agresívne a ich stupeň je vysoký....

Kompozície a spôsoby zahŕňajúce KLK3, PSCA alebo FOLH1 antigén


Číslo patentu: E 18742

Dátum: 12.05.2008

Autori: Rothman John, Paterson Yvonne, Shahabi Vafa

MPK: A61K 39/00, A61P 35/00, A61K 39/02...

Značky: kompozície, spôsoby, zahŕňajúce, klk3, antigen, folh1


...na 99 homologická, pričom N-koncový LLO peptid zvyšuje imunogénnosť fúziového peptidu a KLK 3 peptid neobsahuje sígnálnu sekvenciu. Predložený vynález poskytuje aj nukleotidovú molekulu kódujúcu rekombinantný polypeptid a rekombinantnú vektorovú vakcínu kódujúcu rekombinantný polypeptid alebo zahŕňajúcu nukleotidovúmolekulu kódujúcu rekombinantný polypeptid.0008 Predložený vynález poskytuje aj vakcínu, ktorá zahŕňa rekombinantný kmeň...

Proteínové vrstvy a ich použitie v elektrónovej mikroskopii


Číslo patentu: E 10897

Dátum: 23.04.2008

Autori: Noble Martin Edward Mäntylä, Sinclair John Charles

MPK: C07K 14/47, C07K 14/00, C07K 19/00...

Značky: vrstvy, použitie, proteinové, elektrónovej, mikroskopii


...sa podľa predloženej prihlášky vynálezu získa postup uskutočnenia elektrónovej mikroskopie, ktorá pozostáva zozískania proteínovej vrstvy, ktorá má štruktúru, ktorá sa pravidelne opakuje v dvoch rozmeroch a ktorá nesie molekulárne entity, kde každá je pripevnená vo vopred stanovenej pozícií opakujúcej sa štruktúry proteínovej vrstvy auskutočnenie elektrónovej mikroskopie proteínovej vrstvy s molekulárnymi entitami,ktoré sú na ňu...

Spôsob aktivovania pomocnej T bunky a farmaceutický prostriedok na jeho použitie


Číslo patentu: E 20533

Dátum: 27.02.2008

Autor: Sugiyama Haruo

MPK: C07K 14/47, A61K 39/00, A61K 38/00...

Značky: aktivovania, farmaceutický, buňky, spôsob, prostriedok, použitie, pomocnej


...teda funkciu aktivovať imunitný systém uľahčením rastu alebo aktivácie B buniek alebo T buniek. Preto je zvýšenie funkcie pomocnej T bunky prostredníctvom antigenového peptidu viažuceho MHC triedy II (pomocný peptid) pri imunoterapii rakoviny na zvýšenie účinku rakovinovej vakcíny považované za užitočné (nepatentový dokument 9, patentový dokument 13). Do dnešného dňa bol zistený ako pomocný peptid WT 1 len peptid viažuci sa na HLA-DRB 1 O 40 l...

Peptidové vakcíny na rakoviny exprimujúce antigény spojené s tumorom


Číslo patentu: E 17905

Dátum: 21.02.2008

Autori: Tsunoda Takuya, Ohsawa Ryuji

MPK: A61K 39/00, C07K 14/47, A61P 35/00...

Značky: spojené, rakoviny, vakcíny, exprimujúce, tumorom, peptidové, antigény


...Vol.9, pp. 1838-1846). Avšak je ťažké povedať, že predpovedaný peptidový epitop môže byť skrátený na určitú veľkosť a exprimovaný na povrch cieľovej bunky s HLA molekulou a rozpoznaný pomocou CTL. Avšak, algoritmus, napríklad BIMAS) (Parker KC, et al., (1994) J Immunol.152(1)163-75. Kuzushima K, et al., (2001) Blood. 98(6)1872-81. môže navrhnúť HLA molekulu-viažucu peptid, ale navrhnutý peptid nie je taký presný (Bachinsky MM, et al.,...

Vakcíny peptidu odvoddeného od EphA4


Číslo patentu: E 17882

Dátum: 21.02.2008

Autori: Tsunoda Takuya, Ohsawa Ryuji

MPK: A61P 35/00, A61K 39/00, C07K 14/47...

Značky: vakcíny, peptidů, odvoddeného, epha4


...et al., (2001) Blood.98(6)1872-81. môže predpokladať HLA molekulu viažuci peptid, ale predpokladaný peptid nie je tak rigorózny (Bachinsky MM, et. al., Cancer Immun. 2005 Mar 2256.). Teda TAA skríning stále zanecháva veľa spochybnení a zložitosti.0006 Súčasný rozvoj v cDNA microarray technológiách umožnil konštrukciu komprehenzívných profilov génovej expresie Val., (2001) Cancer Res., 61, 2129-37. Lin YM. et al., (2002) Oncogene, 214120-8....

Peptidové vakcíny proti rakovinám exprimujúcim antigény spojené s nádorom


Číslo patentu: E 15192

Dátum: 21.02.2008

Autori: Ohsawa Ryuji, Tsunoda Takuya

MPK: C07K 14/745, C07K 14/47, A61K 39/00...

Značky: spojené, exprimujúcim, antigény, nádorom, vakcíny, proti, peptidové, rakovinám


...a rozpoznaný pomocou CTL. Avšak, algoritmus, napríklad BIMASmolekulu-viažucu peptid, ale navrhnutý peptid nie je taký presný(Bachinsky MM, a kol., Cancer Immun. 2005 Mar 2256.). Teda TAA skríning je ešte stále výzvou s pretrvajúcimi ťažkosťami.0006 Nedávne zdokonalenie CDNA mikrotestovacích technológií umožňuje konštrukcie komplexných profilov génovej expresie v rakovinových bunkách v porovnaní s normálnymi bunkami (Okabe,H. a kol.,...

Oligosacharidy zahrnujúce aminooxy skupinu a ich konjugáty


Číslo patentu: E 14505

Dátum: 18.01.2008

Autori: Zhu Yunxiang, Cheng Seng, Jiang Canwen, Avila Luis

MPK: A61K 47/48, A61K 31/738, A61P 43/00...

Značky: skupinu, aminooxy, zahrnujúce, konjugáty, oligosacharidy


...sacharidu alebo molekuly obsahujúcej sacharid, funkcionalizovaných aspoň jednou oximovou väzbou. US 20020137125 opisuje veľmi fosforylované manopyranozyl oligosacharidové deriváty obsahujúce manózo-ô-fosfát (MGP) alebo iné oligosacharidy nesúce iné koncové hexózy. US 20050048047 sa týka intratekálneho (IT) podania rekombinantného enzýmu na liečenie porúch Iyzozomálnej akumulácie.0008 Aminooxy skupiny sú obzvlášt užitočné...

Fúzne proteíny obsahujúce antigény rejekcie tumorov NY-ESO-1 a LAGE-1


Číslo patentu: E 13341

Dátum: 11.01.2008

Autori: Blais Normand, Brichard Vincent, Palmantier Remi, Martin Denis, Rioux Clément, Boyer Martine, Louahed Jamila

MPK: A61K 39/00, C07K 14/47

Značky: rejekcie, obsahujúce, tumorov, fúzne, ny-eso-1, antigény, proteiny, lage-1


...C-koniec skráteného LAGE-1 je zasa fúzovaný s N-koncom skráteného NY-ESO-1, za vzniku fúzneho proteínu s dĺžkou 289 aminokyselín. Ďalšie podrobnosti o konštrukte sú uvedené vTabuike 1Obrázok 10 znázorňuje schému prlkladu rekombinantného polypeptidu, zahmujúceho NY-ESO-1 s čiastočne skrátenou doménou podobnou kolagénu. Epitopy znázornená na Obráutoch 10 až 13 sú len príkladmi epitopov uvádzaných pre tento proteín a neboli...



Číslo patentu: E 12855

Dátum: 11.01.2008

Autori: Blais Normand, Martin Denis, Palmantier Remi

MPK: A61K 39/00, C07K 14/47, C07K 14/285...

Značky: vakcína


...aspekte vynález poskytuje FRAME časť ñízneho proteínu, ktorá zahŕňa. pozostáva z alebo v podstate pozostáva z kompletného proteínu.0016 Vynález však zahŕňa aj FRAME konštrukty s konzervatívnymi substitúciami. V jednom uskutočnení môže byť substituovaných l. 2, 3, 4. 5. 6, 7, 8, 9 alebo viac aminokyselín. FRAME konštmkt, ako je tu opísaný, môže okrem toho,alebo altemativne. obsahovať delćcie alebo inzercie vo svojej aminokyselinovej...

Vysokocitlivé imunologické testy a súpravy pre určenie peptidov a proteínov pre biologické použitie


Číslo patentu: E 11742

Dátum: 05.12.2007

Autor: Sarasa Barrio J Manuel

MPK: G01N 33/68, C07K 14/47, C07K 16/18...

Značky: súpravy, biologické, vysokocitlivé, určenie, proteínov, použitie, peptidov, imunologické, testy


...spoľahlivý, reprodukovateľný, neinvazívny, jednoducho vykonateľnýV predchádzajúcich postupoch a znalostiach sú známe metódy pre diagnostiku AD prostredníctvom detegovania hladín biomarkerov prítomných v mozgu alebo CSF pacientov. Boli charakterizované rôzne biomarkery, ktorých zisťovanie je vykonávané v CSF. CSF reŕlektuje priamo zloženie extracelulámeho priestoru centrálneho nervového systému a tak, poskytuje vyššie koncentrácie ako...

Modifikované fúzie Fc s rozpustným receptorom FGF so zlepšenou biologickou aktivitou


Číslo patentu: E 9846

Dátum: 28.11.2007

Autori: Nicolazzi Céline, Nesbit Mark, Blanche Francis, Cameron Beatrice, Trombe Marc, Sordello Sylvie

MPK: A61K 47/48, C07K 14/47, A61K 38/17...

Značky: fúzie, aktivitou, zlepšenou, rozpustným, biologickou, modifikované, receptorom


...funkcie, ktore zahŕňajú dva hlavné mechanizmy na protilátkach závislú bunkovú cytoloxícitu (AnIibody-Dcpentlent Ccll-medialed Cytotoxicity, ADCC) a komplementiumobjavuje, ak sa mAb najpw viaže prostrednictvom svojho väzbovćho miesta na zintigén ksvojmu cieľu na nadorovýeh bunkách, a potom je časť Fe rozpoznaná špcciíickými receptormi FC (Fe receptors, FCR) na efektorových bunkách (tj. NK, neutrotiloch,makrotäzach), ktoré atakujú Cieľovou...

Metastínové deriváty a ich použitie


Číslo patentu: E 19261

Dátum: 24.10.2007

Autori: Asami Taiji, Nishizawa Naoki

MPK: A61K 38/16, C07K 14/47

Značky: metastínové, použitie, deriváty


...pankreasu atď.). Derivát metastínu podľa predloženého vynálezu ajeho soli majú vplyvy na regulovanie funkcií placenty a sú užitočné ako liečivá na predchádzanie/ liečenie choriokarcinómu, hydatidóznej moly, invazívnej moly, spontánneho potratu, fetálnej hypoplázie, abnorrnálneho metabolizmu glukózy,abnorrnálneho metabolizmu tukov alebo indukcie pôrodu.0009 Taktiež majú derivát metastínu podľa predloženého vynálezu a jeho soli vplyvy na...

Polymérové konjugáty obsahujúce Box-A z HMGB1 a Box-A varianty z HMGB1


Číslo patentu: E 9594

Dátum: 14.09.2007

Autori: Lorenzetto Chiara, Beccaria Luca, Fumero Silvano, Morena Sebastiano, Mainero Valentina, Traversa Silvio

MPK: A61M 25/00, A61K 47/48, C07K 14/47...

Značky: box-a, konjugáty, polymérové, varianty, hmgb1, obsahujúce


...liekov môže byt brzdený in vivo faktormi, akými sú napríklad rozpustnost pri fyziologickom pH, rýchla eliminácia prostredníctvom glomerulárnej filtrácie, bunková eliminácia a bunkový metabolizmus, ako aj schopnosťou absorbovať. Učinnost perorálneho podávania je napríklad brzdená trávením proteínov pri perorálnom užívaní. Na druhej strane je účinnost systémovéhopodávania brzdená tým, že proteíny menšie ako 65-70 kDa sa rýchlo...

Aktivačný komplementový faktor H na použitie pri liečení chorôb


Číslo patentu: E 17500

Dátum: 21.06.2007

Autori: Holers Michael, Gilkeson Gary, Rohrer Baerbel, Tomlinson Stephen

MPK: C07K 14/47, C07K 14/705

Značky: liečení, použitie, aktivačný, faktor, komplementový, chorôb


...448 až H 457), a syndrómu respiračnej úzkosti dospelých (R. Rabinovici a ďalší, J. lmmunol, 1992, 149 strana 1744 až 1750). Okrem tohosú saktiváciou komplementu tiež úzko spojené ďalšie zápalové stavy aautoimunitné/imunitné komplexné ochorenia (BP Morgan Eur J. Clin invest, 1994, 24 strana. 219 až 228), vrátane tepelných poškodení, ťažkej astmy, anafylaktického šoku,črevných zápalov, urtikárie, angioedému, vaskulitídy, roztrúsenej sklerózy,...

Regulatórne prvky nukleových kyselín


Číslo patentu: E 13624

Dátum: 15.06.2007

Autori: Sautter Kerstin, Enenkel Barbara

MPK: C12N 15/63, C07K 14/47, C12N 15/67...

Značky: prvky, regulatórne, nukleových, kyselin


...čiastkový fragment z LCR s veľkosťou 6 kb, pôsobí ako otvárač chromatínu a nie je tkanivo-špecifický. Tkanivovú špecitickosť zaisťuje T-bunkovo špecifická expresia v týmuse prostredníctvom HS 7, 8 a 1 (3 kb). Len V úplnej kombinácii všetkých HS je TCRotLCR funkčne kompletná (0 rtiz et al., 1997). Presnejšie rozčlenenie a špecifikáciu jednotlivých HSfunkcií TCRotLCR je možné zistiť v (0 rtiz et al., 1999). Tento príklad ukazuje, že kontrolné...

Vylepšené antimikrobiálne peptidy


Číslo patentu: E 16718

Dátum: 15.05.2007

Autori: Malmsten Martin, Schmidtchen Artur

MPK: A61K 38/17, A61K 38/10, A61K 38/04...

Značky: peptidy, vylepšené, antimikrobiálne


...Ešte dôležitejšia je potreba nových 2antimikrobiálnych peptidov, ktoré sú nealergénne pri aplikovaní u cicavcov ako napríklad u ľudí.0017 Kvôli potenciálnej Iytickej ako aj iným vlastnostiam AMP voči bakteriálnym membránam ako aj membránam cicavcov sa jedna zťažkých úloh navrhnutia nových peptidov spolieha na vývoj AMP svysokou špecifickosťou voči mikroorganizmom ako napríklad bakteriálnym alebo hubovým bunkám, t.j. vysoký terapeutický...

HLA-A*3303 špecifický peptid WT1 a farmaceutický prostriedok, ktorý ho obsahuje


Číslo patentu: E 12382

Dátum: 21.02.2007

Autor: Sugiyama Haruo

MPK: A61K 35/76, A61K 48/00, A61K 38/00...

Značky: hla-a*3303, ktorý, obsahuje, farmaceutický, specificky, peptid, prostriedok


...sa indukujú WT 1 špecifické CTLs (TAK-1)(nepatentový dokument 12) a indukované CTLs nepotláčajú aktivitu kolónie tvoriacich normálnych hematopoetických kmeňových buniek,ktoré fyziologicky čiastočne exprimujú gén WT 1 (nepatentové dokumenty 13 a 14). Tieto správy silne podporujú tvrdenie, že nielen V myšiach, ale tiež v človeku možno indukovať WT 1 špecifické CTLs, pričom tieto CTLs majú cytotoxický účinok na nádorové bunky exprimujúce gén WT...

Deriváty metastínu a ich použitie


Číslo patentu: E 10706

Dátum: 21.12.2006

Autori: Nishizawa Naoki, Asami Taiji

MPK: A61K 38/16, C07K 14/47

Značky: deriváty, metastínu, použitie


...podľa (1) až (2), alebo jeho soli, na pripravu lieku na prevenciu alebo liečenie Alzheimerovej choroby, autizmu, alebo mierneho zhoršenie kognicie.(22) Derivát metastínu podľa (1) alebo (2), alebo jeho soľ, na použitie vo forme prostriedku na downreguláciu gonadotropného hormónu alebo pohlavného hormónu.(23) Derivát metastínu podľa (1) alebo (2), alebo jeho soľ, na použitie vo forme prostriedku na downreguIáciuIudského proteínu OT 7 T...

Účinné analógy compstatínu


Číslo patentu: E 12481

Dátum: 28.11.2006

Autori: Lambris John, Katragadda Madan

MPK: C07K 14/47, A61K 38/16, A61K 38/08...

Značky: analogy, účinné, compstatínu


...štiepenie C 3 na 03 a a C 3 b C 3 konvertázami. Compstatín bol testovaný v sériách experimentov in vitro, in vivo, ex vivo, a medzifázových in vivo/ex vivo a bo|o preukázané, že (1) inhibuje aktiváciu komplementu vľudskom sére (Sahu A a kol., 1996), (2) inhibuje heparínom/protamínom vyvolanú aktiváciu komplementu u primátov bez významných vedľajších účinkov (Soulika AM a kol., 2000), (3) predlžuje dobu života prasacieho xenograftu pre...

Prenos génov do kmeňových buniek epitelu dýchacích ciest s použitím lentivírusového vektora pseudotypovaného spike proteínom RNA vírusu


Číslo patentu: E 20738

Dátum: 27.10.2006

Autori: Alton Eric W, Inoue, Mitomo Katsuyuki, Hasegawa Mamoru, Iwasaki, Griesenbach Uta

MPK: A61K 35/76, A61K 38/17, A61K 38/00...

Značky: vírusu, vektora, spike, buniek, proteínom, génov, dýchacích, pseudotypovaného, lentivírusového, prenos, kmeňových, použitím, ciest, epitelu


...zavedenie génov do kmeňových buniek epitelu dýchacích ciest.0009 Autori predkladaného vynálezu uskutočnili odborný výskum pre vyriešenie vyššie uvedených problémov. Presnejšie, pre vytvorenie vektorov schopných zaviesť gény do kmeňových buniek epitelu dýchacích ciest sa pseudotypovaii vektory vírusu opičej imunodeficiencie (SIV), ako zástupca lentivírusu, obálkovými glykoproteínmi F a HN, čo sú spike proteíny Sendai vírusu ako zástupcu RNA...

Bunkovo-permeabilné peptidové inhibítory dráhy prenosu JNK signálu


Číslo patentu: E 12167

Dátum: 12.09.2006

Autor: Bonny Christophe

MPK: C07K 14/47

Značky: signálu, dráhy, bunkovo-permeabilné, peptidové, přenosu, inhibitory


...(generic) (s) ü 38 XXXXXXXRKK RRQRRRXXXX XRPTTLXLXX xxxxxooxCOOH D-TAT-IB 1 (s) DQSRPVQPFL NLTTPRKPRP PRRRQRRKKR G (NHDQSRPVQPFLNLTTPRKPRPPRRRQRRKKRGCOOHD-TAT-IB XDQXXXXXXX LXLTTPRXXX XXRRRQRRKK RXXXXXXX(V Tabuľka 1 sú vzorové sekvencie, ako aj ich genetické vzorce uvádzané v zodpovedajúoom poradí ako SEQ ID N 0 1 2 5 6 9 a 11 resektíve ako SEQ lD NO 3, 4 7 810 a 12.001 B Akekolvek tu oplsané peptidy môžu byt...

Bunkovo priepustné peptidové inhibítory dráhy prenosu JNK signálu


Číslo patentu: E 20864

Dátum: 12.09.2006

Autor: Bonny Christophe

MPK: C07K 14/47

Značky: přenosu, inhibitory, bunkovo, dráhy, signálu, peptidové, priepustné


...JBD v IBl a IB 2 odhalílo aj dva bloky so siedmymi a troma aminokyselinamí,ktoré sú v rámci týchto dvoch sekvencií vysoko konzervatívne.0008 Sekvencie skonštruované na základe takéhoto zosúladenia sú opísané napr. vo W 0 01/27268. Konkrétne, W 0 O 1/27268 opisuje malé bunkovo-perrneabilné fúzne peptidy zahŕňajúce takzvanú TAT bunkovú perrneačnú sekvenciu získanú zo základnej dopravovacej sekvencie HIV-TAT proteínu a minimálnej...