Archív za 2006 rok

Strana 50

Systém modulovania osteochondrálneho vývoja pomocou terapie využívajúcej impulzné elektromagnetické pole

Načítavanie...

Číslo patentu: E 19572

Dátum: 30.05.2006

Autori: Ganey Timothy, Gordon Stephen, Kronberg James

MPK: A61N 1/32, A61N 1/40

Značky: impulzné, terapie, pomocou, modulovania, osteochondrálneho, vývoja, systém, využívajúcej, elektromagnetické

Text:

...na vyššiu frekvenciu, komplikovanejšiesignály často bez čistej jednosmemej zložky.0009 Nanešťastie sa väčšina teraz dodávaných elektroterapeutických zariadení spolieha na priamu implantáciu elektród, alebo celé elektronické balíky, alebo na induktívnu väzbu cez kožu pomocou cievok, ktoré generujú časovo premenlivé magnetické polia, čím sa vyvolávajú slabé vírivé prúdy v tkanivách tela, ktoré neefektívne zabezpečujú signál do tkanív a takto...

Spôsob výroby flexibilnej elastomérnej kompozitnej polyuretánovej povrchovej vrstvy

Načítavanie...

Číslo patentu: E 7999

Dátum: 30.05.2006

Autori: Benoit Kristof, Vanlandschoot Koen, De Wilde Peter, Van Houcke Geert, De Winter Hugo, Vanluchene Yvan

MPK: B29C 67/24, B32B 27/40, C08G 18/28...

Značky: elastomérnej, výroby, povrchovej, flexibilnej, spôsob, kompozitnej, polyuretánovej, vrstvy

Text:

...špeciálnych organobizmutových alebo organocínatých katalyzátorov, v ktorých je atóm kovu viazaný k organickým skupinám s dlhým reťazcom, ako je oleylová, linoleylová alebo linolenylová skupina. Avšak vpraxi môže použitie týchto katalyzátorov spôsobovať procesné problémy kvôli nižšej kompatibilites polyolovou zmesou, do ktorej sú pridávané. Emisie prchavých organických zlúčenin môžu byt ďalej znížené zvýšením NCO-indexu, čo však vedie k...

Delenie stereoizomérnych N,N-dialkylamino-2-alkyl-3-fenylalkánov

Načítavanie...

Číslo patentu: E 13909

Dátum: 29.05.2006

Autori: Buschmann Helmut Heinrich, Hell Wolfgang

MPK: C07C 213/10, C07C 217/72

Značky: stereoizomérnych, n,n-dialkylamino-2-alkyl-3-fenylalkánov, delenie

Text:

...a používa sa namiesto toho takmer výlučne na analytické účely. Existuje preto požiadavka na spôsob, ktorý je tiež vhodný na delenie enantiomérov chirálnych N,N-dialkylamino-2 alkyl-3-hydroxy-3-fenylalkanov v preparatívnom meradle.0012 Preto úlohou tvoriacou základ tohto vynálezu je poskytnúť spôsob delenia stereoizomérov, výhodne enantiomérov, chirálnych N,N-dia|kylamino-2-aIkyl-3 hydroxy-3-fenylalkánov, ktorý sa môže tiež uskutočňovať v...

Indolínové zlúčeniny

Načítavanie...

Číslo patentu: E 5592

Dátum: 29.05.2006

Autori: Bondoux Michel, Lebreton Luc, Dumas Christine, Massardier Christine

MPK: C07D 401/00, A61K 31/403, C07D 209/00...

Značky: indolínové, zlúčeniny

Text:

...Tiež bolo preukázané, že agonistícké ligandy LXR redukujú ateromatózne lézie u dvoch rôznych myších modelov (myši ApoE-l- a myši LDLR-/-) (Proc. Natl. Acad. Sci. USA 2002 99 7604-7609, FEBS Letters 2003 536 6-11). Ztýchto výsledkov možno usudzovat, že ligandy LXR môžu predstavovať terapeutícké látky na liečbu aterosklerózy.0016 Nakoniec je známe, že makrofágy hrajú dôležitú úlohu pri zápale,hlavne pri patogenéze aterosklerózy. Bolo preukázané,...

Zapaľovacia plazmová sviečka pre spaľovací motor

Načítavanie...

Číslo patentu: E 4952

Dátum: 29.05.2006

Autori: Jaffrezic Xavier, Agneray André

MPK: H01T 13/00

Značky: spalovací, plazmová, motor, sviečka, zapaľovacia

Text:

...podľa vynálezu.Obrázok 3 znázorňuje schematický rez indukčnej časti sviečky obsahujúcej dva pláštepodľa vynálezu. Obrázok 4 znázorňuje schematický rez podľa osi 4-4 z Obrázok 3 podľa vynálezu.Obrázok 5 znázorňuje prúdenie prúdov súvisiacich s elektromagnetickým polom vreze podľa osi 5-5 z obrázku 3 podľa vynálezu.Rovnaké alebo analogícke prvky sú na obrázkoch označené rovnakými vzťahovýmiZ obrázku l je zrejmé, že vysokofrekvenčná...

Bis(akridínkarboxamidový) alebo bis(fenazínkarboxamidový) derivát, spôsob prípravy, použitie a farmaceutické prostriedky

Načítavanie...

Číslo patentu: 285121

Dátum: 29.05.2006

Autori: Spicer Julie Ann, Gamage Swarnalatha Akuritaya, Denny William Alexander, Baguley Bruce Charles, Finlay Graeme John

MPK: A61K 31/435, A61K 31/498, C07D 219/00...

Značky: přípravy, bis(fenazínkarboxamidový, farmaceutické, bis(akridínkarboxamidový, derivát, prostriedky, spôsob, použitie

Zhrnutie / Anotácia:

Bis(akridínkarboxamidové) alebo bis(fenazínkarboxamidové) deriváty všeobecného vzorca (I), kde každé X, ktoré môže byť rovnaké alebo rôzne v danej molekule, je -CH= lebo -N=, každé z R1 až R4, ktoré môžu byť rovnaké alebo rôzne, znamenajú H, C1-C4 alkyl, OH, SH, NH2, C1-C4 alkoxy, aryl, aryloxy, NHR, N(R)2, SR alebo SO2R, kde R je C1-C4 alkyl, CF3, NO2 alebo halogén, alebo R1 a R2 tvoria spoločne s atómom uhlíka, ku ktorému sú viazané,...

Usporiadanie automobilového vozidla na pridržanie napájacej hadičky kvapaliny ostrekovača

Načítavanie...

Číslo patentu: E 4264

Dátum: 29.05.2006

Autori: Vigneau Cédric, Brulet Jean-michel, Deysson Guillaume

MPK: B60S 1/46

Značky: ostrekovača, hadičky, kvapaliny, napájacej, vozidla, pridržanie, automobilového, usporiadanie

Text:

...pozdĺžnu, vertikálnu a priečnunaznačenú trojhranom L,V,T z obrázkov 1 až 3. Prvky identické alebo analogické sú označené rovnakými referenčnými číslami.Tak, ako je to znázomené na obrázku 1, kapota 10, tu V otvorenej pozícii, je kĺbovo spojená s karosériou (neznázomené) vozidla prostredníctvom pántu 12 (na obrázkoch je znázornený jediný). Prvé zakončenie 14 pántu 12 je pripojené ku kapote 10 adruhe zakončenie 16 jeupevnené na prvok 18...

Prvok karosérie na vyplnenie oblúka strechy automobilového vozidla a automobilové vozidlo majúci takýto prvok

Načítavanie...

Číslo patentu: E 4045

Dátum: 29.05.2006

Autori: Henri Jérome, Loche Denis

MPK: B62D 25/06

Značky: prvok, střechy, vozidlo, vyplnenie, karosérie, automobilové, oblúka, vozidla, majúci, takýto, automobilového

Text:

...sa vyplnenia oblúka strechy pre rovnaký typ automobilového vozidla, či je navrhnuté a vyrobené s jednými bočnými dverami z každej strany alebo s dvoma bočnými dverami z každej strany neodlíšujú inak než stranou karosérie pre ktorú boli určené. Možno teda používat rovnaký prvok karosérie na rovnakej strane karosérie, bez rozlišovaniadvojdverovej alebo štvordverovej verzie karosérie vozidla.Navyše nosiče držadiel sú upevnené ako nerozoberateľne...

Azolopyridín-2-ónové deriváty ako inhibítory lipáz a fosfolipáz

Načítavanie...

Číslo patentu: E 7729

Dátum: 27.05.2006

Autori: Heuer Hubert, Zoller Gerhard, Müller Günter, Petry Stefan, Tennagels Norbert

MPK: C07D 498/00, A61P 3/00, A61K 31/00...

Značky: inhibitory, deriváty, azolopyridín-2-ónové, lipáz, fosfolipáz

Text:

...N-, pričom jedna skupina C(-R-)- je nahradená N Y je -0-, -s R je rovnaké alebo rôzne, a je vodík, halogén, (C.-C 5)-alkyl, hydroxy, trifluórmetyl,mono-(C 1-Ca-alkylamínokarbonyl, di-(Cg-CąQ-alkylaminokarbonyl, COOR 3,(CLCQ-alkylsulfonyl, aminosulfonyl, (C 6 C 0)aľyl, (C 5-C 1 g)-heteroaryl, (C.-C 6)-alkylkarbonyl, CO-NR 6 R 7, O-CO-NR 6 R 7, O-CO-(Cl-CQ-alkylén-CO-O-(C.-C(,)-alkyl, O-CO-(C 1-C 5)-alkylćn-CO-NR 6 R 7 alebo nesubstituovaný...

Spôsob prípravy rosuvastatínu a medziproduktov

Načítavanie...

Číslo patentu: E 7358

Dátum: 26.05.2006

Autori: Donát Andrea, Vukics Krisztina, Erdelyi Péter, Szöke Katalin, Fischer János, Szemzö Attila

MPK: C07D 239/00, C07D 405/00

Značky: spôsob, medziproduktov, přípravy, rosuvastatínu

Text:

...vode s výťažkom 82 . Metylamínová soľ je prevedená znovu na sodnú soľ s 8 hmotu. vodným roztokom hydroxidu sodného a rnetylamín je odstránený komplikovaným destilačným procesom. Konečný produkt je pripravený zo sodnej soli dihydrátu chloridu vápenatého. Aplikácia neobsahuje žiadne dáta o výťažku konečného produktu.0006 Medzinárodná patentová prihláška WO 00/49014 opisuje dlhý, komplikovaný spôsobprípravy obsahujúci šesť operačných krokov na...

Chladiace zariadenie a spôsob riadenia

Načítavanie...

Číslo patentu: E 7075

Dátum: 26.05.2006

Autori: Soysal Alper, Erenay Kerem

MPK: F25B 49/02

Značky: zariadenie, spôsob, riadenia, chladiace

Text:

...rýchlosti Q. Ked sa časový interval Ľ skončí, kompresor g začne činnost tým, že je napájaný cez elektronickú kartu Q s premenlivou rýchlosťou, to znamená rýchlosťou odlišnou od konštantnej rýchlosti /o, napríklad vyššou rýchlosťou 11, aby sa zabezpečilo potrebné chladenie (obr. 3).0022 Keď kompresor g pracuje, prúd j prechádza cez tepelnú ochranu g a dosiahne motor kompresora g. Tepelná ochrana gje umiestnená v elektrickej rozvodnej skrini na...

Spojenie rúrok

Načítavanie...

Číslo patentu: E 6521

Dátum: 26.05.2006

Autori: Wagner Alfred, Mocivnik Josef

MPK: F16L 15/00, F16L 13/00

Značky: spojenie, rúrok

Text:

...čiastkovou oblasťou, tak sa týmzaistí, že aj pre prípad mimostredového namáhania v oblasti spojenia rúrok medzi prvou rúrkoua druhou nirkou, a tým vznikajúceho kontaktovania medzi vnútri ležiacim koncovým úsekom azvonka ležiacou oblasťou plášťa prekrývajúceho koncového úseku, sa v tejto oblasti udržíintegrita spojenia, a hlavne sa zabráni deštrukcii, respektíve poškodeniu obklopujúcehokoncového úseku, respektíve jeho oblasti plášťa....

Vylepšené metódy imunoanalytických stanovení

Načítavanie...

Číslo patentu: E 6088

Dátum: 26.05.2006

Autori: Barnes Tony, Robertson John Forsyth Russell, Chapman Caroline, Murray Andrea

MPK: G01N 33/564, G01N 33/574, G01N 33/53...

Značky: vylepšené, imunoanalytických, stanovení, metody

Text:

...metodológie testu, ktorá by bola vhodná pre celú populáciu jedincov, ktori majú byt vyšetrení, pretože sa celkové množstvo prítomných protilátok výrazne mení od jedinca k jedincovi. Táto skutočnosť môže spôsobiť vysoký výskyt falošných negatívnych výsledkov, napríklad u jedincov, ktorí majú nízku hladinu protilátky. Podobne sa objavuje problém priposudzovaní pravdivo pozitívnych výsledkov, pretože rozdiel celkového množstva protilátok...

Kontajner, najmä skladovací, stohovací a prepravný kontajner

Načítavanie...

Číslo patentu: E 5939

Dátum: 26.05.2006

Autor: Schäfer Gerhard

MPK: B65D 43/16, B65D 13/00

Značky: kontajner, skladovací, prepravný, stohovací, najmä

Text:

...vybraním.Problém šikmo sa stavajúcich polovic veka tu vôbec nenastáva.0007 Vynález je teda založený na úlohe, poskytnúť kontajner vyššie uvedeného druhu bez opisaných nevýhod, to znamená tak ujednodielneho,ako aj u dvojdielneho veka zabrániť uvoľneniu západkového spojenia a takzabrániť prelomeniu veka, ktoré by sa malo zatvárat stále rovnako ľahko.0008 Táto úloha je podľa vynálezu riešená tým, že sú vytvorené prídavné západkové...

Zlepšené spôsoby imunotestov

Načítavanie...

Číslo patentu: E 12087

Dátum: 26.05.2006

Autori: Murray Andrea, Barnes Tony, Robertson John Forsyth Russell, Chapman Caroline

MPK: G01N 33/564, G01N 33/53, G01N 33/574...

Značky: spôsoby, imunotestov, zlepšené

Text:

...primáma biliáma cirhóza (PBC), autoimunitná tyreoiditída (napr. Hashimotova tyreoíditída), autoimunitná gastritída (napr. pemiciózna anémia), autoimunitná adrenalitída (napr. Addisonova choroba), autoimunitný hypo paratyreoidizmus, autoimunitný diabetes (napr. diabetes 1. typu), myasthenia gravis.Autori tohto vynálezu zistili, že keď sú testy založené na detekcii protilátok, použité diagnosticky alebo prognostícky na stanovenie chorobného...

Mechanizmus pre posuvné sklo

Načítavanie...

Číslo patentu: E 11230

Dátum: 26.05.2006

Autor: Tarrega I Lloret

MPK: E05D 15/06

Značky: mechanizmus, posuvné

Text:

...valčekov V smere kolmom k posunu skla, a pričom vrchné zadržovacie zarážky sú vybavené príslušnými horizontálnymi plošnými prvkami, ktorých voľné konce majúzakrivenú sekciu na zadržanie valčekov. Stručný opis výkresovObrázok 1 ukazuje pohľad z boku, na ktorom sú znázornenéprvky, tvoriace uskutočnenie mechanizmu podľa vynálezu. Obrázok 2 je perspektívny pohľad závesného zariadeniaObrázok 3 je perspektivny pohľad na jednu vrchnú(0007)...

Piperazínové a piperidínové zlúčeniny, spôsob ich prípravy, farmaceutické kompozície, ktoré ich obsahujú, a ich použitie

Načítavanie...

Číslo patentu: 285119

Dátum: 26.05.2006

Autori: Kuipers Wilma, Feenstra Roelof Willem, Tulp Martinus Theodorus Maria, Long Stephen Kenneth, Kruse Cornelis Gerrit

MPK: A61K 31/495, A61K 31/445, A61K 31/435...

Značky: zlúčeniny, použitie, piperidínové, obsahujú, přípravy, spôsob, farmaceutické, piperazinové, kompozície

Zhrnutie / Anotácia:

Opisujú sa piperazínové a piperidínové zlúčeniny vzorca (a), spôsob ich prípravy, použitie v medicíne a farmaceutické kompozície s ich obsahom. Zlúčeniny vzorca (a) majú vysokú afinitu k dopamínovým receptorom D2 a serotoninovým receptorom 5-HT1A a sú vhodné na prípravu liečiv na liečenie porúch centrálneho nervového systému, akými sú napríklad schizofrénia, Parkinsonova choroba, agresivita, stavy úzkosti, autizmus, vertigo, depresia a poruchy...

Spôsob výroby syntézneho plynu pomocou parného reformingu

Načítavanie...

Číslo patentu: 285118

Dátum: 26.05.2006

Autori: Lucassen Hansen Viggo, Dybkjaer Ib, Seier Christensen Peter, Rostrup-nielsen

MPK: C01B 3/00

Značky: spôsob, výroby, reformingu, plynů, pomocou, syntézneho, parného

Zhrnutie / Anotácia:

Je opísaný spôsob výroby plynu bohatého na vodík a monoxid uhlíka pomocou parného reformingu z privádzaných uhľovodíkov v prítomnosti katalyzátora na parný reforming, spevneného na stene reaktora vo forme tenkého filmu, ktorý pozostáva z týchto krokov: (a) voľného prietoku zásobného procesného uhľovodíkového plynu cez prvý reaktor s tenkým filmom katalyzátora parného reformingu, spevneným na stenách reaktora, v teplovodivom pomere s prúdom...

Bezpečnostné zariadenie na automatickú kontrolu otvárania strešných okien, okien alebo dverí

Načítavanie...

Číslo patentu: 285117

Dátum: 26.05.2006

Autori: Caoduro Carlo, Caoduro Paolo

MPK: A62C 2/00, E05F 15/20

Značky: bezpečnostné, okien, dveří, zariadenie, kontrolu, automatickú, otvárania, strešných

Zhrnutie / Anotácia:

Bezpečnostné zariadenie na automatickú kontrolu otvárania strešných okien, okien alebo dverí alebo podobne, obsahuje teleso (2) ventilu, v ktorom je vytvorená komora (5), ktorá je prepojená aspoň s plynovým servopohonom na otváranie strešného okna, ďalej piest (6) vložený vnútri komory (5) a vybavený na jednom konci kolíkom (7) a na druhom konci elastickým prvkom (8) na zaistenie svojho axiálneho pohybu piesta (6) v komore (5), ďalej tlakovú...

Uzatváracia klapka na tlakové priestory a spôsob jej výroby

Načítavanie...

Číslo patentu: 285116

Dátum: 26.05.2006

Autor: Möllmann Dieter

MPK: F16K 1/22

Značky: tlakově, spôsob, výroby, uzatváracia, priestory, klapka

Zhrnutie / Anotácia:

Uzatváracia klapka (10) na tlakové priestory, najmä na nádoby alebo potrubia, je vyrobená s kotúčom (11) klapky otočným v telese (12) relatívne vzhľadom na os (13) otáčania, ktorý v tesniacej polohe uzaviera prietok telesom (12) v dvoch navzájom opačných smeroch prúdenia v oblasti tesnenia. Kotúč klapky môže byť usporiadaný excentricky s osou (13) otáčania mimo os tesnenia. Os (13) otáčania prechádza najmä hlavnou osou (17) uzavieracej klapky...

Zariadenie na vysoko pružné upevnenie železničných koľajníc na štandardné betónové podvaly

Načítavanie...

Číslo patentu: 285115

Dátum: 26.05.2006

Autor: Eisenberg Helmut

MPK: E01B 9/00

Značky: vysoko, podvaly, upevnenie, zariadenie, pružné, betonové, koľajníc, železničných, štandardné

Zhrnutie / Anotácia:

Zariadenie na vysoko pružné upevnenie železničných koľajníc (12) na pevnej jazdnej dráhe zahŕňa štandardný betónový podval (16) používaný na štrkovú koľaj. Železničné koľajnice (12) sú vedené vždy medzi dvoma uhlovými vodiacimi doskami a tlačené sú upínacou svorkou (34) proti betónovému podvalu (16). Medzi pätkou (14) koľajnice a štandardným betónovým podvalom (16) je umiestnená pružná medzidoska (52) a uhlové vodiace dosky (30) majú na konci...

Textilný pás

Načítavanie...

Číslo patentu: 285114

Dátum: 26.05.2006

Autor: Eckhardt Gerhard

MPK: F16G 3/00

Značky: textilný

Zhrnutie / Anotácia:

Textilný pás (1), ako je napr. sitový, dopravníkový pás alebo im podobný, má na čelnom leme pásoviny upevnené stočené špirály (4), ktoré sú spolu posúvateľné a sú spolu zavesiteľné prostredníctvom zasunuteľného drôtu, kolíka alebo im podobného. Stočená špirála (4) je rozdelená na každom čelnom okraji na tri úseky, a to dva úzke okrajové úseky (7) a jeden stredný úsek (3), pričom každý úsek je spojený s pásom nezávisle od ostatných úsekov....

Potrubná prípojka

Načítavanie...

Číslo patentu: E 11124

Dátum: 26.05.2006

Autori: Smahl Jarmo, Larsson Thomas

MPK: F16L 47/16, F16L 15/08

Značky: přípojka, potrubná

Text:

...znázorňuje pohľad z boku na časť potrubnej prípojky v reze.0010 Obrázok schematícky znázorňuje časť potrubnej prípojky 1. Potrubná prípojka 1 môže byť koleno alebo T-kus alebo priama prípojka alebo akákoľvek vhodná potrubná prípojka.0011 Potrubná prípojka 1 obsahuje plastové teleso 2 a výstužný prstenec 3 uložený okolo plastového telesa 2. Materiál plastového telesa môže byť napríklad polypropylén PP, polyetylén PE, polyfenylsulfón PP-SU,...

Bunky odvodené z plodovej vody

Načítavanie...

Číslo patentu: E 21006

Dátum: 26.05.2006

Autori: Xu Jean, Rezania Alireza

MPK: C12N 5/073

Značky: buňky, odvodené, plodovej

Text:

...Izolácia progenítorových buniek alebo čiastočne diferencovaných buniek zo surových extraktov tkaniva pankreasu sa môže dosiahnuť použitím protilátok proti markerom bunkového povrchu. Napríklad, U.S. zverejnená prihláška 2004/0241761 opisuje izoláciu myších buniek, ktoré exprimovali ErbB 2, ErbB 3,ErbB 4, MSX-2, PDX~ 1 a inzulín.0009 Gershengorn et al. (Science 306 2261-2264, 2004) uverejňujú produkciu proliferujúcich buniek, ktoré...

Systém odberu vzorky

Načítavanie...

Číslo patentu: E 20887

Dátum: 26.05.2006

Autori: Sjoberg Berndt, Lundkvist Ulf, Nygren Soren, Willander Erik

MPK: A61B 10/00, A61B 10/02

Značky: odběru, vzorky, systém

Text:

...ASCUS) by sa mali ďalej podrobiť riadenému programu, pozostávajúcemu z dvoch opakovaných cytologických testov, to znamená, okamžitej kolposkopie alebo testovaniu DNA na vysoko rizikové typy HPV. Testovanie na DNA, pochádzajúceho zHPV, je uprednostňovaný prístup, pokial sa pre hromadnévyšetrenie používa cytológia založená na kvapaline.0010 Limitujúcim faktorom pre to, aby sa ďalej znížil výskyt a úmrtnosť následkom karcinómukrčka matemice, sa...

Génový vektor obsahujúci MI-RNA

Načítavanie...

Číslo patentu: E 20761

Dátum: 26.05.2006

Autori: Naldini Luigi, Brown Brian David

MPK: A61K 48/00, C12N 15/86, C12N 15/63...

Značky: génový, vektor, mi-rna, obsahujúci

Text:

...na reguláciu vektora. Obzvlášť neopisujú použitie vektorov predloženého vynálezu pre spôsoby génovej terapie na prevenciu imunitne riadeného odmietnutia skúmaného transgénu alebo na vytvorenie prístupov na zvýšenie títeru vírusových častíc exprimujúcich toxické gény, ktoré sú normálne toxické pre bunky, v ktorých sa produkujú0010 Opisuje sa Vektor na prenos génov Vhodný na použitie V génovom inžínierstve, ako sú génová terapia, prenos génu...

Ihibítory cytosolickej fosfolipázy A2

Načítavanie...

Číslo patentu: E 8823

Dátum: 26.05.2006

Autori: Lee Katherine, Williams Cara, Clark James, Clerin Valerie, Vargas Richard, Marusic Suzana, Chen Lihren, Mckew John, Pong Kevin

MPK: A61P 19/00, A61K 31/404, A61P 11/00...

Značky: cytosolickej, fosfolipázy, ihibítory

Text:

...techniky bola určená primárna štruktúra prvého humánneho ne-pankreatického PLA 2. Tento ne-pankreatický PLA 2 bol nájdený v doštičkách, synoviálnej tekutine a v slezine, pričom rovnako predstavuje sekretovaný enzým. Tento enzým je členom vyššie uvedenej rodiny pozri publikácie J. J. Seílhamer et al, J. Biol. Chem., 264.5335-5338 ( 1989) R. M. Kramer et al, J. Biol. Chem., 26415768-5775 (1989) a A. Kando et al, Biochem. Biophys. Res....

Farmaceutický prípravok obsahujúci Lurazidón

Načítavanie...

Číslo patentu: E 14302

Dátum: 26.05.2006

Autor: Fujihara

MPK: A61K 9/20, C07D 417/12, A61K 31/496...

Značky: farmaceutický, obsahujúci, lurazidón, prípravok

Text:

...klinické účinky V závislosti od stavu pacientov. Technika opísaná v Patentovom dokumente 2 môže poskytnúť perorálny prípravok, ktorý má rovnaký profil rozpustnosti v rozsahu 5 mg až 40 mg lurazidonu na tabletu, ako je znázornené na obrázku 1. Avšak, ako je znázornená na obrázku 2, keď sa obsah účinnej látky na tabletu zvýši na dvojnásobok, t.j., 80 mg tableta, nebude mať rovnaký profil rozpustnosti. Preto, zostáva stav podávania...

Systém na ochranu proti prepísaniu

Načítavanie...

Číslo patentu: E 7439

Dátum: 25.05.2006

Autori: Lee Kyung-geun, Hwang Sung-hee, Weirauch Charles

MPK: G11B 19/12, G11B 19/04, G11B 20/00...

Značky: ochranu, proti, systém, prepísaniu

Text:

...jednotky, ktorá obsahuje ako normálne údaje, tak aj informácie o oprave chýb, informácie o adrese, ktorá sa tradične nazýva ECC blok - napríklad disky DVD majú najmenšiu zaznamenateľnú jednotku 37 856 bajtov, z ktorých 32 768 bajtov predstavujú normálne časti alebo časti používateľských údajov ECC bloku. Vzhľadom na to, že minimálna záznamová jednotka je taká rozsiahla, obsahuje tradične okrem informácií slúžiacich na vyznačenie...

Zostava uhlových podpier z jedného kusu

Načítavanie...

Číslo patentu: E 12997

Dátum: 25.05.2006

Autor: Faus Badia Vicente Gabriel

MPK: A61C 8/00

Značky: podpier, zostava, úhlových, jedného

Text:

...pre každú z nich. čo slúži na dosiahnutie rozdielneho závitového uhla pre každú podperu. čo umožňuje dosiahnutie požadovanej orientácie alebo sklonu výčnelku protetickej podpery alebo stĺpika.0025 Táto variácia zahŕňa jedno otočenie počiatočného závitu spodnej časti podpery. Požadovaná orientácia sa môže tiež dosiahnut zmenou dĺžky spodnej časti vo veľmi malých hodnotách.0026 Spôsob použitia je doplnený o jednoduchý prídavný implantát....

Protilátky viažuce TWEAK

Načítavanie...

Číslo patentu: E 17123

Dátum: 25.05.2006

Autori: Garber Ellen, Burkly Linda, Lugovskoy Alexey

MPK: C07K 16/28, A61K 39/395, A61P 35/00...

Značky: tweak, viažúce, protilátky

Text:

...IgG 1 (napr. humánny IgG 1). Typicky je konštantné oblasť ťažkého reťazca humànna alebo je to modifikovanà forma humánnej konštantnej oblasti. V ďalšom uskutočnení sa konštantná oblast ľahkého reťazca vyberá napr. z kappa alebo Iambda, najmä kappa0010 Protein môže zahŕňať jednu z nasledujúcich sekvencllDIVMTQTPLSLPVTPGEPASISCRSSQSLVSSKGNTYLHWYLQKPGQSP QLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCSQSTH FPRT (SEQ ID...

Potenciátory AMPA receptora

Načítavanie...

Číslo patentu: E 4922

Dátum: 25.05.2006

Autori: Cordier Frederic Laurent, Hong Jian Eric, Jiang Delu, Castano Mansanet Ana Maria, Hornback William Joseph, Dominguez-manzanares Esteban

MPK: A61P 25/00, A61K 31/44, A61K 31/381...

Značky: receptora, potenciátory

Text:

...J. Physiol. 424, 533 až 543 (1990) a A. Copani a kol., Journal of Neurochemistry 58, 1199 až 1204 (1992). Tieto zlúčeniny sa tiež prejavujú zvýšením schopnosti učenia a zlepšením pamäte u krýs, opíc a ľudí a o tom0006 Zverejnená medzinárodná patentová prihláška WO 98/33496,publikovaná 6. augusta 1998, opisuje určité sulfónamidové deriváty, ktoré sú vhodné napriklad na liečenie psychiatrických a neurologických porúch,napríklad kognitivneho...

Dopravníkový merač na kontrolu plošnej hustoty minerálnej vlny

Načítavanie...

Číslo patentu: 285112

Dátum: 25.05.2006

Autori: Širok Brane, Možina Peter, Mihovec Bojan, Bradeško Franc

MPK: G01G 11/00

Značky: minerálnej, kontrolu, dopravníkový, plošnej, hustoty, merač

Zhrnutie / Anotácia:

Dopravníkové merače v procese výroby minerálnej vlny na kontrolu a nastavovanie špecifickej plošnej hustoty minerálnej vlny pri výrobe minerálnej vlny sa zakladajú na meraní hmotnostného toku minerálnej vlny. Celá konštrukcia dopravného pásu (2) je spolu s hnacím motorom (3) zavesená na pohyblivých tyčiach (4) v štyroch pokojových bodoch, pričom časť gravitačnej sily konštrukcie dopravného pásu (2) a hnacieho motora (3) je zachytená...

Prací alebo čistiaci prostriedok vo forme tvarovaných teliesok, spôsob jeho výroby a jeho použitie

Načítavanie...

Číslo patentu: 285108

Dátum: 25.05.2006

Autori: Jung Dieter, Kruse Hans-friedrich, Schambil Fred, Blasey Gerhard

MPK: C11D 3/22, C11D 11/00, C11D 17/00...

Značky: spôsob, prací, teliesok, tvarovaných, použitie, čistiaci, formě, prostriedok, výroby

Zhrnutie / Anotácia:

Aktívny prací alebo čistiaci prostriedok vo forme tvarovaných teliesok, najmä tabliet, ako sú tablety pracieho prostriedku, tablety prostriedku na umývanie riadu, tablety na odstraňovanie škvŕn alebo tablety na zmäkčovanie vody, obsahuje rozvoľňovadlo, ktoré je v prostriedku v granulovanej, prípadne kogranulovanej forme, pričom granulát rozvoľňovadla obsahuje minimálne 20 % hmotn. rozvoľňovadla a rozdelenie veľkosti častíc zistené sitovou...

(S)-N-metylnaltrexón, proces jeho syntézy a jeho farmaceutické využitie

Načítavanie...

Číslo patentu: E 15359

Dátum: 25.05.2006

Autori: Andruski Stephen, Verbicky Christopher, Boyd Thomas, Sanghvi Suketu, Wagoner Howard

MPK: A61P 1/12, A61K 31/485, A61P 25/04...

Značky: využitie, proces, s)-n-metylnaltrexón, syntézy, farmaceutické

Text:

...priradenie naloxán diastereomérov pre levalorfan. Bolo by výhodne extrapolovať konfiguráciu k týmto diastereomerom (R.J. Kobylecki et al, J. Med. Chem. 25, l 278 ~l 280,l 982).0006 Goldbergov a spol. US pat. č. 4,176,186 anovšie Cantrellov aspol. W 0 2004/043964 A 2 opisujú protokol pre syntézu MNTX. Obidva opisujú syntézu MNTX kvartemáciou terciámeho Nsubstituovaného morfmán alkaloidu s metylujúcim činidlom. Tak Goldberg a spol. ako aj...

(R)-N-metylnaltrexón, proces jeho syntézy a jeho farmaceutické využitie

Načítavanie...

Číslo patentu: E 15183

Dátum: 25.05.2006

Autori: Perez Julio, Doshan Harold

MPK: A61P 25/04, A61K 31/485, A61P 1/10...

Značky: využitie, proces, farmaceutické, r)-n-metylnaltrexón, syntézy

Text:

...a naloxónu.0008 Funke Carel W a kol., Žurnál chemickej spoločnosti (Joumal of the Chemical Society),Perkin Transactions 2, 1986, strany 735-738 opisuje protón a C štúdie nukleámej rezonancie kvartémych solí naloxónu a oxymorfónu.0009 Kobylecki RJ, Žumál medicínskej chémie (Journal of Medicinal Chemistry), Americká chemická spoločnosť (American Chemical Society), roč. 25, č. ll, 1982, strany 1278-1280 opisuje N-metylnalorñn a posudzuje...

Kryštalické pevné formy tigecyklínu a spôsoby ich prípravy

Načítavanie...

Číslo patentu: E 14295

Dátum: 25.05.2006

Autori: Krishnan Lalitha, Deshmukh Subodh, Huang James, Hadfield Anthony, Ku Mannching Sherry

MPK: C07C 231/24, C07C 237/26

Značky: tigecyklínu, přípravy, krystalické, spôsoby, formy, pevně

Text:

...formy tam, kde sú molekuly rozpúšťadla alebo vody v kanáloch alebo nie sú zabudované dokryštálovej mriežky. Amorfné formy sú často označované ako pevné formy, ale nie sú to kryštalické pevné formy.0007 Rôzne kryštalické pevné formy rovnakej zlúčeniny často majú rôzne vlastnosti v pevnom stave, ako je teplota topenia, rozpustnosť, manipulácia a stabilita. Preto, akonáhle boli identiñkované rôzne kryštalické pevné formy rovnakej...

Metóda prepravy guľatiny alebo reziva

Načítavanie...

Číslo patentu: E 7436

Dátum: 24.05.2006

Autori: Grentner Bernhard, Wanek-pusset Peter

MPK: B65D 85/20, B65D 61/00

Značky: prepravy, guľatiny, metoda, řeziva

Text:

...sú pozdĺžne nosníky 2 usporiadané hlbšie než hranice nakladania 3. Ďalší proñlovaný oceľový proñl tvorí hranicu 4, ktorá paralelne stredovo spája pozdĺžne nosniky 2 s obomi hranicami nakladania 3. Dve pomocné hranice nakladania 5, ktoré súčasne slúžia ako klzné plochy pre vidlice zdvíhacieho vozíka, sú taktiež privarené ku pozdlžnym nosnikom 2.0012 Na koncoch oboch pozdlžnych nosníkov 2 je zakaždým umiestnená klanica(stlpiková podpera)...

Zariadenie na uzavretie rúry

Načítavanie...

Číslo patentu: E 18582

Dátum: 24.05.2006

Autori: Abeln Michael, Vogelsang Hugo, Krampe Paul

MPK: A01C 23/00, F16K 7/10

Značky: uzavretie, zariadenie, rúry

Text:

...zovretá pomocou napínacieho zariadenia. Napínacie zariadenie má zabezpečiť to, aby poddajná štruktúra mohla byť privedená do stlačeného tvaru, keď má byť blokovacie zariadenie otvorené. Vtejto polohe predstavuje poddajná štruktúra prekážku pre prúdenie, takže sa tam, a tiež na napínacom zariadení, budúzhromažďovať pevné látky hnojovice.0010 Cieľom vynálezu je vytvoriť pre výtokové hadice zariadení typu uvedeného v úvodecielené odpojenie,...

Spôsob a zariadenie na výrobu časti potrubia z minerálnej vlny na izolačné účely

Načítavanie...

Číslo patentu: E 13383

Dátum: 24.05.2006

Autori: Nikkinen Matti, Manninen Jukka, Kuukka Ossi, Skippari Sami, Karjalainen Erkki, Bulut Pirkko

MPK: D04H 1/00, F16L 59/02, D04H 1/76...

Značky: potrubia, minerálnej, výrobu, účely, spôsob, částí, izolačné, zariadenie

Text:

...príkladova obrázkov možno nájsť ďalšie preferované s nimi spojené prvky.0015 Na obrázkoch, Obrázok 1 ukazuje zariadenie podľa vynálezu, kde je dávkovanie vlny ovplyvnené prostriedkami gravitácie a dávkovacou skrutkou, Obrázok 2 ukazuje pristroj podľa vynálezu, kde je dávkovanie vlny ovplyvnené dúchadlom a dávkovacou skrutkou, aObrázok 3 ukazuje prierez úseku na formovanie časti potrubia podľa vynálezu, obsahujúci predlisok časti...