Zverejnene patenty 25.05.2006

Systém na ochranu proti prepísaniu


Číslo patentu: E 7439

Dátum: 25.05.2006

Autori: Hwang Sung-hee, Lee Kyung-geun, Weirauch Charles

MPK: G11B 20/00, G11B 19/12, G11B 19/04...

Značky: systém, proti, prepísaniu, ochranu


...jednotky, ktorá obsahuje ako normálne údaje, tak aj informácie o oprave chýb, informácie o adrese, ktorá sa tradične nazýva ECC blok - napríklad disky DVD majú najmenšiu zaznamenateľnú jednotku 37 856 bajtov, z ktorých 32 768 bajtov predstavujú normálne časti alebo časti používateľských údajov ECC bloku. Vzhľadom na to, že minimálna záznamová jednotka je taká rozsiahla, obsahuje tradične okrem informácií slúžiacich na vyznačenie...

Zostava uhlových podpier z jedného kusu


Číslo patentu: E 12997

Dátum: 25.05.2006

Autor: Faus Badia Vicente Gabriel

MPK: A61C 8/00

Značky: jedného, zostava, úhlových, podpier


...pre každú z nich. čo slúži na dosiahnutie rozdielneho závitového uhla pre každú podperu. čo umožňuje dosiahnutie požadovanej orientácie alebo sklonu výčnelku protetickej podpery alebo stĺpika.0025 Táto variácia zahŕňa jedno otočenie počiatočného závitu spodnej časti podpery. Požadovaná orientácia sa môže tiež dosiahnut zmenou dĺžky spodnej časti vo veľmi malých hodnotách.0026 Spôsob použitia je doplnený o jednoduchý prídavný implantát....

Protilátky viažuce TWEAK


Číslo patentu: E 17123

Dátum: 25.05.2006

Autori: Lugovskoy Alexey, Garber Ellen, Burkly Linda

MPK: A61P 35/00, C07K 16/28, A61K 39/395...

Značky: tweak, protilátky, viažúce


...IgG 1 (napr. humánny IgG 1). Typicky je konštantné oblasť ťažkého reťazca humànna alebo je to modifikovanà forma humánnej konštantnej oblasti. V ďalšom uskutočnení sa konštantná oblast ľahkého reťazca vyberá napr. z kappa alebo Iambda, najmä kappa0010 Protein môže zahŕňať jednu z nasledujúcich sekvencllDIVMTQTPLSLPVTPGEPASISCRSSQSLVSSKGNTYLHWYLQKPGQSP QLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCSQSTH FPRT (SEQ ID...

Potenciátory AMPA receptora


Číslo patentu: E 4922

Dátum: 25.05.2006

Autori: Dominguez-manzanares Esteban, Hong Jian Eric, Castano Mansanet Ana Maria, Cordier Frederic Laurent, Jiang Delu, Hornback William Joseph

MPK: A61P 25/00, A61K 31/381, A61K 31/44...

Značky: receptora, potenciátory


...J. Physiol. 424, 533 až 543 (1990) a A. Copani a kol., Journal of Neurochemistry 58, 1199 až 1204 (1992). Tieto zlúčeniny sa tiež prejavujú zvýšením schopnosti učenia a zlepšením pamäte u krýs, opíc a ľudí a o tom0006 Zverejnená medzinárodná patentová prihláška WO 98/33496,publikovaná 6. augusta 1998, opisuje určité sulfónamidové deriváty, ktoré sú vhodné napriklad na liečenie psychiatrických a neurologických porúch,napríklad kognitivneho...

Dopravníkový merač na kontrolu plošnej hustoty minerálnej vlny


Číslo patentu: 285112

Dátum: 25.05.2006

Autori: Mihovec Bojan, Možina Peter, Širok Brane, Bradeško Franc

MPK: G01G 11/00

Značky: minerálnej, plošnej, kontrolu, merač, hustoty, dopravníkový

Zhrnutie / Anotácia:

Dopravníkové merače v procese výroby minerálnej vlny na kontrolu a nastavovanie špecifickej plošnej hustoty minerálnej vlny pri výrobe minerálnej vlny sa zakladajú na meraní hmotnostného toku minerálnej vlny. Celá konštrukcia dopravného pásu (2) je spolu s hnacím motorom (3) zavesená na pohyblivých tyčiach (4) v štyroch pokojových bodoch, pričom časť gravitačnej sily konštrukcie dopravného pásu (2) a hnacieho motora (3) je zachytená...

Prací alebo čistiaci prostriedok vo forme tvarovaných teliesok, spôsob jeho výroby a jeho použitie


Číslo patentu: 285108

Dátum: 25.05.2006

Autori: Schambil Fred, Jung Dieter, Blasey Gerhard, Kruse Hans-friedrich

MPK: C11D 11/00, C11D 17/00, C11D 3/22...

Značky: teliesok, prostriedok, formě, čistiaci, výroby, prací, tvarovaných, použitie, spôsob

Zhrnutie / Anotácia:

Aktívny prací alebo čistiaci prostriedok vo forme tvarovaných teliesok, najmä tabliet, ako sú tablety pracieho prostriedku, tablety prostriedku na umývanie riadu, tablety na odstraňovanie škvŕn alebo tablety na zmäkčovanie vody, obsahuje rozvoľňovadlo, ktoré je v prostriedku v granulovanej, prípadne kogranulovanej forme, pričom granulát rozvoľňovadla obsahuje minimálne 20 % hmotn. rozvoľňovadla a rozdelenie veľkosti častíc zistené sitovou...

(S)-N-metylnaltrexón, proces jeho syntézy a jeho farmaceutické využitie


Číslo patentu: E 15359

Dátum: 25.05.2006

Autori: Verbicky Christopher, Boyd Thomas, Sanghvi Suketu, Wagoner Howard, Andruski Stephen

MPK: A61P 25/04, A61K 31/485, A61P 1/12...

Značky: využitie, proces, farmaceutické, syntézy, s)-n-metylnaltrexón


...priradenie naloxán diastereomérov pre levalorfan. Bolo by výhodne extrapolovať konfiguráciu k týmto diastereomerom (R.J. Kobylecki et al, J. Med. Chem. 25, l 278 ~l 280,l 982).0006 Goldbergov a spol. US pat. č. 4,176,186 anovšie Cantrellov aspol. W 0 2004/043964 A 2 opisujú protokol pre syntézu MNTX. Obidva opisujú syntézu MNTX kvartemáciou terciámeho Nsubstituovaného morfmán alkaloidu s metylujúcim činidlom. Tak Goldberg a spol. ako aj...

(R)-N-metylnaltrexón, proces jeho syntézy a jeho farmaceutické využitie


Číslo patentu: E 15183

Dátum: 25.05.2006

Autori: Perez Julio, Doshan Harold

MPK: A61K 31/485, A61P 25/04, A61P 1/10...

Značky: r)-n-metylnaltrexón, farmaceutické, využitie, syntézy, proces


...a naloxónu.0008 Funke Carel W a kol., Žurnál chemickej spoločnosti (Joumal of the Chemical Society),Perkin Transactions 2, 1986, strany 735-738 opisuje protón a C štúdie nukleámej rezonancie kvartémych solí naloxónu a oxymorfónu.0009 Kobylecki RJ, Žumál medicínskej chémie (Journal of Medicinal Chemistry), Americká chemická spoločnosť (American Chemical Society), roč. 25, č. ll, 1982, strany 1278-1280 opisuje N-metylnalorñn a posudzuje...

Kryštalické pevné formy tigecyklínu a spôsoby ich prípravy


Číslo patentu: E 14295

Dátum: 25.05.2006

Autori: Huang James, Krishnan Lalitha, Deshmukh Subodh, Hadfield Anthony, Ku Mannching Sherry

MPK: C07C 237/26, C07C 231/24

Značky: pevně, přípravy, formy, tigecyklínu, krystalické, spôsoby


...formy tam, kde sú molekuly rozpúšťadla alebo vody v kanáloch alebo nie sú zabudované dokryštálovej mriežky. Amorfné formy sú často označované ako pevné formy, ale nie sú to kryštalické pevné formy.0007 Rôzne kryštalické pevné formy rovnakej zlúčeniny často majú rôzne vlastnosti v pevnom stave, ako je teplota topenia, rozpustnosť, manipulácia a stabilita. Preto, akonáhle boli identiñkované rôzne kryštalické pevné formy rovnakej...